KEGG   Falco cherrug (Saker falcon): 102055493Help
Entry
102055493         CDS       T02911                                 

Gene name
HSPA8
Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch03040  Spliceosome
fch04010  MAPK signaling pathway
fch04141  Protein processing in endoplasmic reticulum
fch04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:fch00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102055493 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102055493 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102055493 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102055493 (HSPA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fch01009]
    102055493 (HSPA8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fch03041]
    102055493 (HSPA8)
   03009 Ribosome biogenesis [BR:fch03009]
    102055493 (HSPA8)
   03110 Chaperones and folding catalysts [BR:fch03110]
    102055493 (HSPA8)
   04131 Membrane trafficking [BR:fch04131]
    102055493 (HSPA8)
   03051 Proteasome [BR:fch03051]
    102055493 (HSPA8)
   03029 Mitochondrial biogenesis [BR:fch03029]
    102055493 (HSPA8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fch04147]
    102055493 (HSPA8)
Protein phosphatases and associated proteins [BR:fch01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     102055493 (HSPA8)
Spliceosome [BR:fch03041]
 Complex B
  Other components
   Prp19 complex
    102055493 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    102055493 (HSPA8)
Ribosome biogenesis [BR:fch03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    102055493 (HSPA8)
Chaperones and folding catalysts [BR:fch03110]
 Heat shock proteins
  HSP70 / DNAK
   102055493 (HSPA8)
Membrane trafficking [BR:fch04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    102055493 (HSPA8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    102055493 (HSPA8)
Proteasome [BR:fch03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    102055493 (HSPA8)
Mitochondrial biogenesis [BR:fch03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    102055493 (HSPA8)
Exosome [BR:fch04147]
 Exosomal proteins
  Proteins found in most exosomes
   102055493 (HSPA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Motif
Other DBs
NCBI-GeneID: 102055493
NCBI-ProteinID: XP_005440266
Position
Unknown
AA seq 646 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDSVVQSDMKHWPFTVVNDAGRPKVQVEYKGETKSFYPEEIS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKISDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagggaccagctgttggaattgatcttggcaccacctattcctgtgttggcgtc
ttccagcacgggaaggtggaaatcattgccaatgaccagggcaaccggaccacgccaagc
tacgttgccttcacagataccgagaggttgatcggcgatgctgcaaagaatcaagttgca
atgaatccaaccaatacagtttttgatgcgaaacggttgattggccgtagatttgatgat
tctgttgtccagtctgatatgaagcactggcctttcactgtggtgaatgatgctggcaga
ccaaaggtgcaggtggagtacaaaggcgagacaaagagtttctacccagaagaaatttct
tctatggttttaaccaaaatgaaggaaattgcagaagcatatcttgggaagactgttact
aatgctgtggtgactgtgccagcttatttcaatgactctcagcgtcaggctacaaaagat
gctggaaccattgcagggctcaacgtgctgcgaattatcaatgagccgacagctgctgca
atagcctatggcttggacaaaaaggttggtgctgagaggaatgttcttatctttgacctt
ggaggtggcacctttgatgtgtcaattctgactattgaagatggcatctttgaggtgaaa
tccaccgcaggtgacactcacttgggtggagaagactttgacaaccgcatggtcaaccac
ttcatcgctgagttcaagcgcaagcacaagaaagacatcagtgagaacaagagagcagtt
cgtcgcctccgcactgcatgcgagcgtgcaaagcgtactctgtcttctagcacgcaggcc
agtattgaaattgattctctctatgagggtattgacttctacacgtccattaccagagct
cgctttgaagagctgaatgctgacctgttccgtggcacccttgatcctgtggaaaaggcc
ctgcgggatgccaaactcgacaaatcgcagattcatgacatcgtgctggttggtgggtca
acccgtatcccaaagatacagaaactgctgcaggatttcttcaatggcaaagagctgaac
aagagcatcaatccagacgaagctgtggcttacggtgcagctgttcaggctgctattctg
tctggagacaagtctgagaatgtgcaggatctgctgctcttggatgtgactcctctgtcc
ctcggtattgagactgctggaggtgtcatgacagtcctgatcaagcggaataccaccatc
cccaccaagcagactcagacgttcacaacttactctgacaaccagcctggtgtgctgata
caggtgtatgaaggagagcgtgctatgactaaggacaacaacttgctgggcaagtttgag
ctgaccggcattccccctgctcccagaggtgtacctcagattgaagtaaccttcgatatt
gatgccaatggcatcctgaatgtgtccgctgtggataagagcactggcaaggagaacaag
atcacaataacaaatgacaagggccgtctgagcaaggaggacatcgagcggatggttcag
gaagcagagaaatacaaagcagaagatgagaagcagcgtgataaagtgtcttccaagaac
tccctggagtcatacgcatttaatatgaaagctactgttgaagatgagaagctccagggc
aagatctctgatgaagataagcagaaaatcctggacaagtgtaatgaaatcatcaactgg
ctggacaagaaccagaccgctgagaaggaggagtttgagcaccagcagaaggagctggag
aaggtgtgcaaccccatcatcaccaagctgtaccagagcgcaggtgggatgcctggtggg
atgcctggcggattccctggtggtggagcacctccatctggtggagcctcttctggacca
accattgaggaggtggactaa

DBGET integrated database retrieval system