KEGG   Falco cherrug (Saker falcon): 102055660Help
Entry
102055660         CDS       T02911                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X2
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04012  ErbB signaling pathway
fch04068  FoxO signaling pathway
fch04137  Mitophagy - animal
fch04140  Autophagy - animal
fch04141  Protein processing in endoplasmic reticulum
fch04210  Apoptosis
fch04217  Necroptosis
fch04310  Wnt signaling pathway
fch04510  Focal adhesion
fch04530  Tight junction
fch04620  Toll-like receptor signaling pathway
fch04621  NOD-like receptor signaling pathway
fch04622  RIG-I-like receptor signaling pathway
fch04625  C-type lectin receptor signaling pathway
fch04910  Insulin signaling pathway
fch04912  GnRH signaling pathway
fch04914  Progesterone-mediated oocyte maturation
fch04920  Adipocytokine signaling pathway
fch04933  AGE-RAGE signaling pathway in diabetic complications
fch05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102055660 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102055660 (MAPK9)
   04012 ErbB signaling pathway
    102055660 (MAPK9)
   04310 Wnt signaling pathway
    102055660 (MAPK9)
   04068 FoxO signaling pathway
    102055660 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102055660 (MAPK9)
   04137 Mitophagy - animal
    102055660 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    102055660 (MAPK9)
   04217 Necroptosis
    102055660 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102055660 (MAPK9)
   04530 Tight junction
    102055660 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102055660 (MAPK9)
   04621 NOD-like receptor signaling pathway
    102055660 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    102055660 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    102055660 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102055660 (MAPK9)
   04920 Adipocytokine signaling pathway
    102055660 (MAPK9)
   04912 GnRH signaling pathway
    102055660 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    102055660 (MAPK9)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102055660 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102055660 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102055660 (MAPK9)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102055660 (MAPK9)
Protein kinases [BR:fch01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102055660 (MAPK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 102055660
NCBI-ProteinID: XP_005440683
Position
Unknown
AA seq 424 aa AA seqDB search
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESDRDKLKTSQARDLLSK
MLVVDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVNSNTSPSQSSSINDISSMSTEQTLASDTDSSLDALTGPL
EGCR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgatagtcagttttacagtgttcaagttgcagattcaacattc
actgtactgaaacgttaccagcaattgaagcccataggatcaggggcacagggcattgtt
tgtgctgcctttgatacggtgcttggaataaatgttgccgtaaagaagctgagtcgtcct
tttcagaatcaaacccacgcaaaaagggcttacagagagcttgttcttttaaaatgcgtc
aatcacaaaaatataattagtttattgaatgtatttacaccacagaagtcactagaagaa
tttcaggatgtatacttggttatggagctgatggatgcaaatttgtgccaggttattcat
atggaattggatcatgaaagaatgtcttaccttctttaccaaatgctatgtggtataaaa
catctccactcagctggtatcatccacagagatttgaaacccagcaacatagtagtaaaa
tcagattgtacgctcaaaatccttgattttggactggcaagaacagcatgtactaacttt
atgatgactccgtatgtagtaacgcggtattacagagcaccagaagttatccttggaatg
ggatataaagagaatgttgatatctggtcagttgggtgcatcatgggagaattggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcaatggaataaagttattgaacag
ttaggaacgccatcagcagactttatgaagaaactgcagcctacagtgaggaattatgta
gaaaacaggccaaaatatcctggtattaaatttgaagagctcttcccagactggatattt
ccatcagaatctgatcgtgacaagttaaaaaccagccaagctagagatttattatccaaa
atgcttgtagtagatccagacaagagaatttctgtagatgaagccttacgtcatccttat
attactgtctggtatgatccagctgaagcagaagctcctccgcctcaaatctatgatgca
cagttggaagaaagagaacatgcgattgaagaatggaaagaattaatatacaaggaagta
atggattgggaagaaaggagcaagaatggtgtggtaaaagatcagccctcagatgcagca
gtgaatagcaacaccagtccttcccagtcatcatctatcaatgacatttcatccatgtca
acagagcaaacattggcctcagatacagacagcagcctcgatgccttgacaggacccctt
gaaggatgtcgatga

DBGET integrated database retrieval system