KEGG   Falco cherrug (Saker falcon): 102055781
Entry
102055781         CDS       T02911                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fch01002]
    102055781 (ADAMTS13)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102055781 (ADAMTS13)
Peptidases and inhibitors [BR:fch01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102055781 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 ADAM_spacer1 TSP1_spondin TSP1_CCN Reprolysin_3 Reprolysin_4
Other DBs
NCBI-GeneID: 102055781
NCBI-ProteinID: XP_027665254
Position
Unknown
AA seq 1360 aa
MLVSLVIWALVMLPLGSCWPSPSREKFLSALDAEDVFSYFGASSVSDVPEFVLAEPTCPC
REEQIGLMSCRIQHCSVEAWGELYAFEFLEDHALLSSSFVSNQVVNSSFSLLKRFSGNCF
AGGNPLRPPGAVCRVTYCEGQLQGVVIADEEKIHIRPVRSKDVALLKDLGFSRPHILFRS
ATREANTARAGRFPSRLQKRAEGAVKHLELMVIAGPDVYLYHKEDTERYILANLNIGAEL
LRDASLGAHFRVHLMQMLVLREPEAEVNITTNITSSLISVCEWSKKVNPQNDSDPQHADI
VLYVTRFDLELPDGNKELRGVTQLGGVCSSFWSCVITQDTGFDLGITIAHEIGHSTGQTN
CLNDLPDMDGSIPGWKPGLYYGADEQCKIAFGSVATACTFADSNVDICEVLSCHVQPADK
SSCTRLLVPLLDGTECGINKWCSKGQCSSLEELNPMAVVHGQWSGWSPFSPCSRSCGGGV
VLRQRFCNNPRPAFGGQECRGASVQAEMCNTQDCLMTQQDFMAEQCAATNLKPLYLTVEA
PSFYTWTSAVGFAKGDMLCKHMCRAIENQFMVSREDSFVDGTRCEQDDSERHGAFNLCVM
GSCRAFGCDGQMHSKKVMDSCKVCGGDNTTCTEVSGSYTEGKAKEYVTFLSLPYNTTLVR
ITNRRPLFTHLAVKVKGEYVVAGKGKISLNVTYPSALEDNQIKYKVFLTKDNLPSLEEVH
VDGPTQEEIEIQVYRRYGKEYGNVTNPDITFSYFVPRENLTYVWVPQQGPCSVTCGEGTQ
PVDHVCFDQTKNEIIEDQWCLERPQPLSEQKPCAMEPCLYRWKMSQIGECSALCGTGVAQ
QNLTCVQFRDGSESVVDDSLCPAEEKPLSIVPCVVNVCPLGWDKEEDAQLLQTSESLGHI
QLENRTVYVWSPLAGECSVSCGRGKTQVQYVCVAFDTKEETQEENCHPVPKPESRTEVCD
LRPCPPRWKVTPAGPCSSSCGPGLAVQLVTCVQIHHGKEVLLEERLCPVAEKPLTRVPCV
IRMCSYEWSFSEWSECSTSCGNGIQTRQDFCLNPLTRKQVNPIFCRHFPKAIVVRGCSAG
PCPEQVVGTGSRGAELQAGTPAVPPMTAAATKEAISKDLDLPPSAAPAVPREGTETSGDV
CGKLFLNATGVINMMGVESSDCTVAIGRPLREEVTVSILASSLNCSAGEVVLFSGRMMWR
TGCRNLPLSLINSRTNTLIVKQRVLLPGNGVILQYNSRTATKKYYQDCDKQLFGPQGEIV
NPVQLPGGRRAVVCRTFITVAPRHRIAIRALYIDLDKESNKTHFNYILVRDVSTMKTMVF
HGKHQFFWESTGSQAEIEFHENVNDRWTSFWAEYHAIEPK
NT seq 4083 nt   +upstreamnt  +downstreamnt
atgctcgtcagcttggtgatctgggcgctcgtgatgctccccttgggctcctgctggccg
tcgccgtcccgagagaaatttctcagcgctttggatgcagaagatgttttctcttatttt
ggagccagctcagtgtctgatgtacctgagtttgtccttgctgagccaacttgcccttgt
agagaagaacagattgggctgatgtcctgccgcattcagcattgctctgttgaggcctgg
ggagagctctatgccttcgaatttctagaggatcatgccctcctttcctcttcctttgtg
agcaatcaagtggtgaactcttcctttagcttactgaagcgattctcaggcaactgcttt
gcaggtggaaatccactgcggcctcctggggctgtatgtagagtgacctactgtgaaggg
cagctgcaaggagtcgtcattgcagatgaggaaaagattcatatcaggcctgtcagaagc
aaagatgtggctctgctgaaagacctcggcttttccagacctcacattctcttcagaagt
gccacaagagaggcaaatacagcaagagcagggcggtttccttctcgcctgcagaagagg
gctgagggagctgtcaaacatctggagctgatggtcatagccggtccagatgtttacttg
taccacaaagaggacacggagcgatatattcttgccaacctgaacattggagcagagctg
ctgagagatgcctcgctgggtgctcatttcagggttcatcttatgcaaatgcttgttttg
agagaaccagaggctgaggtgaacatcacaaccaatatcacctcctcgctgatcagcgtt
tgtgagtggagcaagaaggtcaacccccagaatgactctgacccccagcatgctgacatt
gtcctctacgtcaccaggtttgacctggagttacctgatgggaacaaggagctacgtgga
gtgactcaattaggtggagtttgctcctccttctggagctgtgttattacccaggacact
ggctttgaccttggaatcaccatagcccatgagattgggcacagcacaggccaaacaaac
tgcttaaatgacctgccggacatggacggcagcatccctggatggaagcctggcttgtac
tatggagcagatgagcaatgtaaaatagcctttgggagcgttgccacagcatgcaccttt
gctgacagcaatgttgacatctgtgaagttctctcatgccatgtacaaccagcagacaaa
tccagctgtactcggcttcttgttcccctcttggacggcactgagtgtggaatcaataag
tggtgctccaagggacagtgcagctctctggaagaactgaatcccatggctgtagtccat
gggcagtggtccggctggagccccttctccccctgctcccgcagctgtggaggtggggtt
gtgttaaggcagcggttctgcaacaaccccaggcctgcttttggtgggcaggagtgccgt
ggtgccagcgttcaagcagagatgtgcaatactcaggactgtttgatgacccagcaggac
tttatggctgaacaatgtgcagcaacaaatttaaagccactgtatctcactgtagaagca
ccatccttttatacctggacttctgctgttggctttgccaaaggggacatgctatgcaag
catatgtgcagggccattgaaaaccagttcatggtaagccgtgaagacagtttcgtagat
ggaaccagatgtgagcaggatgactcggagcgccatggggctttcaatctgtgtgtaatg
ggaagctgtagagcattcgggtgtgatggccagatgcactccaagaaggtaatggactct
tgcaaggtctgtgggggcgataataccacttgcactgaagtgagtgggtcttacaccgaa
ggaaaagctaaagagtacgtcacatttctgtccttgccttataacaccaccttggtccgc
attaccaatcggagaccactcttcacacacttggctgtgaaggttaaaggagagtatgtg
gttgctggaaaagggaaaatttcactgaacgtcacctatccatcggctctggaagacaac
cagatcaaatacaaagtgtttctcaccaaggacaacctgccaagcctagaggaagtccat
gtggatggaccaacacaagaagaaattgaaatacaggtctatcgaaggtatggaaaagaa
tatggcaacgtcaccaacccagacatcaccttcagctactttgtccccagagagaatctg
acgtacgtgtgggttcctcagcaggggccgtgctcagtgacctgtggggaagggacacaa
ccagtggatcacgtgtgctttgaccagacaaagaatgaaataatagaggatcagtggtgt
ctggagcgcccgcagcccctttcagagcagaagccctgtgccatggagccatgcctgtac
aggtggaagatgtctcagataggcgaatgctctgctctctgtggaactggagttgcccag
cagaatctgacctgtgttcagtttcgtgatggatcggagtctgttgtggatgacagcttg
tgcccagcagaagagaaacccctctccattgtgccctgtgtggtcaatgtctgcccttta
ggctgggacaaagaggaagatgcacaattacttcagacttcagagtcacttgggcatatc
caactggaaaatcggactgtgtatgtctggagccctctggctggcgagtgttccgtctcc
tgtggtagaggtaagactcaggtgcagtatgtatgtgtggcttttgacaccaaagaggaa
acccaagaagaaaactgtcatccagtgccaaagccagagagcaggacggaagtctgcgac
ctccgtccctgcccaccaagatggaaggtaaccccagcaggcccctgttcctccagctgt
gggcctggcttagctgttcagctggtcacctgtgtgcagattcaccacggcaaggaggtt
ttgctggaggagcgtttgtgtcctgtggcagagaagccccttacccgtgtcccctgtgtc
atccgaatgtgctcttacgaatggagcttcagcgagtggtcagagtgttcaacttcgtgt
gggaatggcattcagacacggcaggatttctgcctcaacccgctaacccgtaagcaggtg
aaccccatcttctgcaggcacttccccaaggccattgtggtacgtggctgctccgcgggg
ccctgtcctgagcaggtggtggggaccgggtcccgtggcgcagagctgcaggcagggaca
ccagccgtgcctccgatgacagctgcagccaccaaagaggcaatttccaaggacttggat
cttcctccatctgctgcgccagctgtgcctcgggaagggacagagaccagtggagatgtc
tgtggaaagctctttcttaacgccactggggtcatcaacatgatgggtgtagagagcagc
gactgcacggtggccatcggacgtcccctcagggaggaggtgacagtcagcatcctggcg
agctccctcaactgcagcgcaggtgaggtagtgctgttttctgggcgaatgatgtggcgg
acaggctgcaggaatctccctttgtcactgataaattccagaacgaatacgctgattgtg
aaacagcgtgttttgctgccaggaaacggggtcatccttcagtacaacagcagaactgca
actaaaaaatattaccaagactgtgacaagcagctgtttggtccccaaggtgaaatagtg
aatcctgtgcaactgcctggtggaaggcgagcagtagtgtgtcggaccttcatcactgtg
gctcctcggcatcgcatagctatccgagccctatacattgacctagacaaagagagcaac
aaaacgcattttaattacatcctggtccgtgatgtaagcaccatgaagacgatggtgttc
catgggaaacatcagttcttctgggaatcgacaggaagccaagctgaaattgaattccat
gaaaatgttaatgatcgctggaccagtttctgggctgaatatcatgctatcgagcctaaa
taa

DBGET integrated database retrieval system