KEGG   Falco cherrug (Saker falcon): 102055990
Entry
102055990         CDS       T02911                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00230  Purine metabolism
fch00240  Pyrimidine metabolism
fch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102055990
   00240 Pyrimidine metabolism
    102055990
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102055990
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_33
Other DBs
NCBI-GeneID: 102055990
NCBI-ProteinID: XP_027663068
Position
Unknown
AA seq 179 aa
MLYDKPTRWAYTFQTYACLSRVRAQLKPISAKLHEAEHPVQFFERSVYSDRYVFASNLFE
SGNINETEWTIYQDWHMWLLNQFESDLELDGMIYLRTTPQKCKERLQMRGREEEQGIELE
YLENLHNKHEAWLYERTMRVDFENLKEIPILVLDVDEDFKNDKIKQEYLIDQVKSFLSS
NT seq 540 nt   +upstreamnt  +downstreamnt
atgctgtatgataaacccacaagatgggcttacacatttcagacttacgcttgcttgagc
agagtaagagcgcaattaaaacccatctcagccaagctacatgaagcagaacatccagtg
caattttttgaaagatctgtgtacagtgacagatacgtatttgcttctaacctgtttgag
tctggaaacattaatgaaactgagtggacaatttatcaggactggcacatgtggcttttg
aatcagtttgaatcagacctagaactggatggcatgatctacctaagaaccacacctcag
aaatgcaaggaaaggctacagatgaggggaagagaagaggaacaaggaattgaacttgag
tatttggaaaacctccacaataaacatgaagcctggctttatgaaaggactatgagagtt
gattttgagaaccttaaagaaattcccatcctagttttggatgttgatgaagattttaag
aatgataagattaaacaggagtatttgattgaccaggtcaagtctttcctgagttcctaa

DBGET integrated database retrieval system