KEGG   Falco cherrug (Saker falcon): 102056735Help
Entry
102056735         CDS       T02911                                 

Gene name
ST6GAL2
Definition
(RefSeq) ST6 beta-galactoside alpha-2,6-sialyltransferase 2
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00510  N-Glycan biosynthesis
fch00514  Other types of O-glycan biosynthesis
fch01100  Metabolic pathways
Module
fch_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    102056735 (ST6GAL2)
   00514 Other types of O-glycan biosynthesis
    102056735 (ST6GAL2)
Enzymes [BR:fch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     102056735 (ST6GAL2)
Glycosyltransferases [BR:fch01003]
 Terminal extension
  Sialyltransferase
   102056735 (ST6GAL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 102056735
NCBI-ProteinID: XP_005444817
Position
Un
AA seq 529 aa AA seqDB search
MKPNLKQWKQLMLFGIFAWGLLFLVIFIYFTDSNTADPVPSSFSYIETKRLLPLQGKQRV
IMGAIHDPSFSENIDGNEVLLNEDLLGTFKSGTGSIKKWTDLEDAFRNEDEFFPSQIGRK
SKSAFYQVNDNYLFAAGQPRSHNHLQEIAKLISADEDNPKVNILQNNWSHQRRMRRRSTK
HRRSQMLDESDDWDGLYSTMSKSFLYKLWKGDVSSKMLNPRLQKAMKDYLSTNKHGVRFK
GKRNSKLTGDQLFCELKERVNVKTIDGKEAPFSTLGWEKHVPQIPLGKLYTHGFGSCAVV
MSAGAILNSSLGDEIDSHDAVLRFNSAPTRGYEKDVGNKTTMRIINSQILTNPNHHFVDS
SLYKDVILVAWDPAPYSANLNVWYKKPDYNLFTPYVQHRRKHPNQPFYILHPKFIWQLWD
IIQENTKEKIQPNPPSSGFIGILIMMSMCNEVHVYEYIPSVRQTDLCHYHELYYDAACTL
GAYHPLLYEKLLVQRMNKGLQDDLYRKGKVILPGFKAVKCPERNNFPHL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctaacttgaagcaatggaaacaactcatgctgtttgggatctttgcatggggt
ctcctttttctggtgatattcatctattttacagatagcaacactgctgacccagttccg
agttccttttcttacattgaaactaagaggcttctgccccttcagggcaagcagagagtc
atcatgggagccattcatgatccatcattctctgaaaacattgatgggaatgaggtactt
cttaatgaagatctcttaggtacttttaaatcggggactggaagtattaagaaatggacc
gacttggaagatgcctttagaaatgaagatgagttttttccatcccagataggaagaaaa
tcaaaaagtgctttctaccaagtgaatgacaattatttatttgctgctggtcagcctcgg
tcacacaaccaccttcaagagatagcaaaattaatctcagctgatgaggataatccaaaa
gtaaatattttacagaacaactggagccatcagagaagaatgaggagaaggagcacaaag
cacaggagaagccagatgcttgatgaatctgatgactgggatgggctatattccacaatg
tcaaaatcctttctttacaagctttggaaaggggatgtctcttccaagatgctaaaccct
cgactgcagaaagcaatgaaagattatttgagcaccaataagcatggggtgcggttcaag
gggaaacgaaactctaagttgacaggagaccagctattctgtgagctaaaagaaagggtg
aatgtgaaaacaatagatggcaaggaggctcccttctccacacttggatgggaaaagcac
gttccccaaattccactgggcaaattatatacacatggctttgggagctgtgccgtagtt
atgtctgctggtgcaatactgaactcctctctaggggatgaaatagattctcatgatgcc
gttctaagatttaattctgctccaacacgtggctatgaaaaagatgttggaaataaaaca
accatgcggatcattaactctcagattctcaccaatccaaaccatcactttgttgacagc
tccttgtacaaagatgttatcttagtagcctgggatcctgctccctactctgcaaatctg
aatgtgtggtataagaagccagactacaatctgttcactccctacgtacagcatcgcagg
aagcatccaaaccagccgttttacattctccatccaaagtttatatggcagctgtgggac
atcatacaggagaacactaaagagaaaatacaacccaatcctccttcttcaggttttatt
ggtatcctcatcatgatgtccatgtgtaatgaagtacacgtgtacgaatacatcccttca
gtccgacagactgacctgtgtcactaccatgagctctactatgatgcagcttgtacctta
ggggcctaccacccactgctctatgagaagctgttggtgcagaggatgaacaaaggtttg
caggatgatttgtatcggaaggggaaagtcattttgccagggttcaaagctgtcaagtgc
cctgagcgaaataatttcccacacttgtag

DBGET integrated database retrieval system