KEGG   Falco cherrug (Saker falcon): 102056935Help
Entry
102056935         CDS       T02911                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00511  Other glycan degradation
fch00600  Sphingolipid metabolism
fch01100  Metabolic pathways
fch04142  Lysosome
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    102056935
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102056935
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102056935
Enzymes [BR:fch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102056935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 102056935
NCBI-ProteinID: XP_005434671
Position
Unknown
AA seq 642 aa AA seqDB search
MEALGGLVSXPPAACLWPLGQVSGEFCKCCGSTESSHWSEVAKPSSGSSSAAQSHELSSP
GLTFPAPPDTVTSYHAPQKAGPAAPLPCTQQDTAGGFFGSGPGACRRRPSKPCCSGGAMG
PGCASVLGWLLLAQAASRVAGGRPCDAKDFGHGSLVCVCNATYCDTLDPVVLPAPGTYVK
YESSKAGKRLERSEGSFQHNTKTPDFHLTLDTAQRYQKVKGFGGSVTDSAAINIQSLSKD
AQNHLLRSYFSEEGIEYNLVRVPMASTDFSIRLYTYADAEGDFELKHFNLTEEDTRMKIP
ILQAAQAVAKRPLSLYASPWTSPVWMKTNGAMTGRGTLKGSPGDKYHQAWAKYFIRFLDE
YAKYNLTFWAVTAGNEPTAGEIVFYPFQCLGFSPEHQRDFIAQDLGPALANSSHRNVQLI
ILDDQRVMLPYWAQVVLKDPVAASYISGIGIHWYLDFLAPIDLTLSITHHLFPDYFLLST
EASTGSYFWEPRVVLGGWDRGSKYSHSILTNLNNYVTGWTDWNLALDLEGGPNWSKNYVD
SPIIVDSSKDVFYKQPMFYHLGHFSKFIPEGSQRVGLAVSKKCRRCDLEHSAFLRPDGAI
VLVVLNRSPVDVSFGVSDPRVGFIEATAPSDSIQTFLWRQPA
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggaggcacttgggggactggtgagcnatccccctgcagcttgcctctggccactggga
caggtttcaggagagttttgcaaatgttgcggtagtacagaaagctctcattggagcgag
gttgcaaaaccttcctcaggctcctcttcagctgcacagtcccatgagctgtcctctcct
ggactcacctttcctgctccaccagacaccgtcacctcctaccacgcaccccagaaagca
ggtcctgccgccccgctgccctgcacccagcaagacacggcaggagggtttttcggcagc
ggccctggtgcttgccgtcggcgtccgtccaagccgtgctgcagcggaggtgccatgggg
cctgggtgtgccagcgtcctgggctggcttctgctggcgcaggcagcatcgcgggtagca
ggcggccgcccctgcgacgccaaggacttcggccacggctccctggtgtgcgtctgcaac
gccacgtactgcgacacgctggaccccgtggtcctgccggccccgggcacctacgtcaag
tacgagagcagcaaggctggcaagcggctggagcgcagcgaggggagcttccagcacaac
accaagaccccagatttccatctcaccctggacacggcgcagcgataccagaaggtgaag
ggctttggcggttctgtcacagactcggctgccatcaacatccagtccctgtccaaggat
gcccagaaccacctgctccgctcctatttctccgaggaaggcattgagtacaacctcgtg
cgcgtccccatggccagcactgacttctccatccgcctgtacacctatgctgatgcggag
ggcgactttgagctgaagcacttcaacctgacggaggaggacacacggatgaagatcccc
atccttcaggcagcccaggcggtggccaagcggccactgtcgctgtatgccagcccctgg
acctctccagtctggatgaagacaaacggcgcgatgacagggagggggacgctgaagggc
agccccggggacaagtaccaccaggcctgggccaagtacttcatccggttcctggatgaa
tacgccaagtacaacctgaccttctgggcagtgacggcagggaatgagcccacggccggt
gagatcgtcttctaccccttccagtgcctgggcttctcccctgaacaccagcgggacttc
atcgcacaggacctgggccctgcgctggccaacagctcccaccgcaacgtccagctcatc
atcctggatgaccagagggtgatgctgccctactgggcccaggtggttctcaaagacccc
gtggctgccagctacatcagcggcatcggcatccactggtacctggacttcctggcaccc
atcgacctcacgctctccatcacccaccacctcttcccggattatttcctcctctccacg
gaggcctccactggctcctacttctgggagcccagggtggtgctgggcggctgggaccgc
ggcagcaagtacagccacagcatcctgacgaacctcaacaactacgtgacgggctggacc
gattggaacctggcgctggacctggaggggggccccaactggagcaagaactacgtggac
agccccatcatcgtggacagcagcaaggatgtcttctacaagcagcccatgttctaccac
ctggggcacttcagcaagttcatccccgagggctcacagcgtgtggggctggctgtctcc
aagaagtgccgccggtgtgacctggagcactcagctttcctgcgcccggatggcgccatc
gtcctggtggtcctgaaccgctcccccgtggacgtgtccttcggcgtctccgacccacgg
gtgggcttcatcgaggccacagctcccagcgactccatccagacattcctgtggaggcag
ccagcctag

DBGET integrated database retrieval system