KEGG   Falco cherrug (Saker falcon): 102057320Help
Entry
102057320         CDS       T02911                                 

Gene name
IRAK4
Definition
(RefSeq) interleukin-1 receptor-associated kinase 4 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch04010  MAPK signaling pathway
fch04620  Toll-like receptor signaling pathway
fch04621  NOD-like receptor signaling pathway
fch05164  Influenza A
fch05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fch00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102057320 (IRAK4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102057320 (IRAK4)
   04621 NOD-like receptor signaling pathway
    102057320 (IRAK4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102057320 (IRAK4)
   05168 Herpes simplex virus 1 infection
    102057320 (IRAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fch01001]
    102057320 (IRAK4)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102057320 (IRAK4)
Protein kinases [BR:fch01001]
 Serine/threonine kinases: TKL group
  IRAK family
   102057320 (IRAK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Death Focal_AT
Motif
Other DBs
NCBI-GeneID: 102057320
NCBI-ProteinID: XP_005444078
Position
Unknown
AA seq 465 aa AA seqDB search
MNKPVTTSTYVRCISYGLMRRLADFIDPQEGWKKLAVDITDPSGESRYNQMHIRRFEAFV
QMGKSPTCELLYDWGTTNCTVADLVDLLIRNQFLAPASLLLPEAVRTAQEVTLPLSSQET
LSIHEKQLPIQEKQVASVKPEYLAQSTEKPHSVPFCLSEENSSLQSNNTDFHNFWFRDLE
SVTNNFDARPESAGGNKLGEGGFGVVFKGFINGRNVAVKKLVAMVDVSVQDLKQQFDQEI
KMMAKCQHENLVELLGFSSDGAQPCLVYEYMPNGSLLDRLACLDNTPPISWNTRCKIVQG
TANGLNFLHENNHIHRDIKSANILLTDTYMPKISDFGLARASVTFTRTIMTERIVGTAAY
MAPEALRGEITPKSDIFSFGVVLLEIITGLPPVEENREPQLLLSIKDEIEDEEATIEDYV
DEKMSDWDAPSVHKMYSIANQCLNEKKNRRPDIKMVQHHLQEIKT
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcccgtaacgacttcgacgtacgtccgctgcattagctatgggctcatgagg
cggctggcagatttcatcgatccgcaagaaggatggaagaaattagcagtcgacatcacc
gacccgtccggtgaaagcagatacaaccaaatgcatataaggagatttgaggcatttgta
caaatgggaaagagccccacatgtgaattgctttatgactggggaacaacaaactgtaca
gttgctgatcttgtggatctgctgattaggaatcaattcttagcaccagcaagccttttg
cttccagaagctgtaaggacggcacaagaagttacattacctctttcttcacaggaaacc
ttgtctatacatgaaaaacaactgcctatacaggaaaaacaagtggcatctgtaaagcca
gagtacttggcccagagtactgagaagccgcattcagttcctttctgcttaagtgaagaa
aatagtagcttacagtccaataacacagatttccataatttttggtttcgtgacttggaa
agtgttacaaataattttgatgcgcgaccagaatcagctggaggcaataaactgggagaa
ggtggctttggcgttgtgttcaaaggctttatcaatggcagaaacgtggctgtcaagaag
ctcgttgctatggttgatgttagtgttcaggacttgaaacagcaatttgatcaagaaata
aaaatgatggcaaagtgtcagcatgaaaatctagtagaattacttggtttctcaagtgat
ggtgctcagccatgtctggtgtatgaatacatgcccaatggttcattgctcgacagactt
gcttgtctggacaatactccaccaatttcttggaatacaagatgtaaaattgttcaaggt
acagcaaatggcctgaactttttgcatgaaaataatcatattcacagagatattaaaagt
gcaaatatcttattaactgatacatatatgccaaaaatttctgactttggacttgcaaga
gcatctgtaacattcacacgaacaatcatgactgaaagaattgttggaacagcagcctat
atggcgcctgaagctctgcgaggagagataacacctaaatctgatatcttcagttttgga
gtagtcttactagaaataataacaggtcttcctccagtagaagaaaaccgggaaccacag
ttactgttaagtatcaaagatgaaattgaggatgaggaagcaaccattgaggattatgtt
gatgaaaagatgagtgactgggatgcaccttcggttcataaaatgtattcgattgctaat
caatgtctgaatgagaaaaaaaacagaaggccagacattaagatggtccaacaccatcta
caagagataaaaacttga

DBGET integrated database retrieval system