KEGG   Falco cherrug (Saker falcon): 102057397Help
Entry
102057397         CDS       T02911                                 

Gene name
DPAGT1
Definition
(RefSeq) UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
  KO
K01001  UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00510  N-Glycan biosynthesis
fch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    102057397 (DPAGT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fch01003]
    102057397 (DPAGT1)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     102057397 (DPAGT1)
Glycosyltransferases [BR:fch01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   102057397 (DPAGT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_4 Gal_mutarotas_2 DUF4133
Motif
Other DBs
NCBI-GeneID: 102057397
NCBI-ProteinID: XP_005437763
Position
Unknown
AA seq 341 aa AA seqDB search
MILFCFIPVPFLRCFVEEQCAAFPHDEFVELIGSLLAICCMIFLGFADDVLNLRWRHKLL
LPTMASLPLLMVYFTNFGNTTIVVPKPFRLLLGMHLDLGIFYYVYMGMLAVFCTNAINIL
AGINGIEAGQSLVIAASIIVFNIVELNGDYQDDHIFSLYFMVPFFFTTLGLFYHNWYPSR
VFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFIPQVLNFLYSLPQLFHVIPCPRHRLPRL
NPSTGKLEMSYSKFKTKSLSALGTHILKAVKILHIVDVRSGTDDDGEYTECNNMTLINFV
IKLIGPTHERNLTLLLLLIQVLGSMIAFSIRYQLVRLFYDV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgttctgcttcatccccgtgcccttcctgaggtgcttcgtggaggagcagtgc
gcggcctttcctcacgatgagttcgtagagctcatcggttctctgcttgccatctgctgc
atgattttcctgggctttgcagatgacgttctgaacctgcgctggcgccacaagctcctg
cttcctaccatggcctctctcccgctgctcatggtttacttcactaactttgggaacact
accatcgtggtgcctaagcctttccggctgctgctgggcatgcacttggacctgggtatc
ttctactatgtgtacatgggcatgctagcagtgttctgcacaaacgccatcaacattctc
gctggaattaatggaattgaagcagggcagtcgctggtgatagctgcttctattattgta
ttcaacattgtagagttaaatggggattaccaagatgatcacattttttctctctacttc
atggttccctttttttttaccacgctggggctgttttaccacaattggtatccatctcga
gtgtttgttggggacactttctgctattttgctggcatgaccttcgctgtggtggggatt
ttggggcacttcagcaaaacaatgctgctttttttcatcccacaagtgctcaacttcctc
tactcgttgcctcaactcttccatgtcattccttgtccccgtcaccggctgccaaggctc
aatcctagtacagggaagctggagatgagctactccaaattcaaaactaagagcctctct
gccctgggaacacacatcttgaaggcagtcaagatcttgcacatagtagatgtgaggagt
ggaacagatgatgatggcgaatacaccgagtgcaataatatgacacttattaactttgtt
ataaagctgattggacccacccacgagcgaaatctgactctcctgctgctactcattcag
gtcctgggtagcatgattgcattttcaatccggtaccaactagtgcgcttgttttatgat
gtctga

DBGET integrated database retrieval system