KEGG   Falco cherrug (Saker falcon): 102057457Help
Entry
102057457         CDS       T02911                                 

Gene name
ABHD12B
Definition
(RefSeq) abhydrolase domain containing 12B
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fch01002]
    102057457 (ABHD12B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fch04147]
    102057457 (ABHD12B)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102057457 (ABHD12B)
Peptidases [BR:fch01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102057457 (ABHD12B)
Exosome [BR:fch04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102057457 (ABHD12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Thioesterase Abhydrolase_3 PP-binding Lipase_3 Peptidase_S9 LIDHydrolase
Motif
Other DBs
NCBI-GeneID: 102057457
NCBI-ProteinID: XP_014132886
Position
Un
AA seq 333 aa AA seqDB search
MLTRCLPCRGWLAWYPQLHILLLHLLLIYISVPFLICLFPVLLTTFVYLNFLAFPFFVDF
RWLELRLNNTISLYLTTKADTTVGIWLAVPSSRGAEARGKDQRWYEEALADAHPVIIYLH
GCERTRAVSHCVQFLKTGAGGVADFHILAFDYRGYGGSSRHPRESGFITDVLALCDWARA
QSGNSSILFWGHSLGTGIATNVARKLQEEXGVQVDAVVLESLYPSIREAAAHIPVSKIYR
QFPGCEYFILDLLALRNMFFCSDKNVKVLTCPLLILHAEDDAVLPLHLGHKLFETAHSTY
KDKTKVKFITFPKKLGLGHNYISFSLELPTLVK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccaggtgccttccttgcaggggctggctggcctggtatccccagctgcacatc
ctcctcctgcacctgcttctcatctacatctctgtgcccttcctcatctgcctcttcccc
gtcttgctcaccacatttgtatacctgaacttcctggccttccccttctttgtggacttt
cggtggctagagctgcggctgaacaacaccatcagcctgtacctcaccaccaaggcagat
accacggttggcatctggctcgcggtgccaagcagcagaggggctgaagcacggggcaag
gaccagcgctggtatgaggaggcacttgctgatgctcaccctgtcatcatctacctgcac
ggctgtgagaggaccagggctgtgagccactgtgtccagttcttgaagacgggggcgggg
ggggttgctgacttccacatcctggcttttgactacagaggctatgggggctccagcagg
caccccagggagagtggcttcatcacggatgtcctggcactctgtgactgggccagagca
caaagcgggaacagcagcatcctcttctggggacactccttggggacaggaattgccaca
aatgtggcaaggaaactgcaggaggagtgaggggtccaagttgacgctgttgtcctggag
tcactgtaccccagcatccgcgaggcagctgcccacatccccgtcagcaagatctaccgc
cagttcccaggttgtgagtacttcatcctggacttgttggctctgcgcaacatgttcttc
tgcagtgacaagaatgtgaaggtgctgacctgcccgctcctcatcctgcatgcagaagat
gatgctgtcctacctctgcacctgggccacaagctctttgagactgctcacagcacctac
aaggacaaaaccaaggtgaagttcattacctttcccaagaagctaggcctgggccacaac
tacatctcattcagcctggagctgcccaccctggtgaagtag

DBGET integrated database retrieval system