KEGG   Falco cherrug (Saker falcon): 102057637Help
Entry
102057637         CDS       T02911                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00564  Glycerophospholipid metabolism
fch00565  Ether lipid metabolism
fch00590  Arachidonic acid metabolism
fch00591  Linoleic acid metabolism
fch00592  alpha-Linolenic acid metabolism
fch01100  Metabolic pathways
fch04010  MAPK signaling pathway
fch04217  Necroptosis
fch04270  Vascular smooth muscle contraction
fch04370  VEGF signaling pathway
fch04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102057637
   00565 Ether lipid metabolism
    102057637
   00590 Arachidonic acid metabolism
    102057637
   00591 Linoleic acid metabolism
    102057637
   00592 alpha-Linolenic acid metabolism
    102057637
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102057637
   04370 VEGF signaling pathway
    102057637
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102057637
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102057637
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102057637
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102057637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 102057637
NCBI-ProteinID: XP_027660593
Position
Unknown
AA seq 952 aa AA seqDB search
MRRGARTPAGTGNVATLLIATPFVFEQTHERIFHSYAIRAFAQASHYDGEALATVEPNTQ
VPPAAPALNTAATXMASTSAFPQHSSGKSSPMEHEGRKWMMRYTALSDADAKQEEMSPYS
LLTVRIIKLKNAHQADFLSQSDCYVSLWLPTASDEKYHTKTIKNCSNPMWNETFYFRIQR
QVKNILEITVSDDDIIRDDDHAIVLFDVAKIPLXXXXLIHLDIHSLPSDXRGMEELEVEF
LLESIRGPPETIITNGAIVCREVACLEVHLDSRMKKKHFSGNELTFTVKGSFEETQRISV
GCASHSPLPDPTFFHYAKYKQPSLDIALTKKRRLPTLCACVPCGARRRCSVPLTLPLKSL
PSEGEAVSEHRKFDLHFKVKKCQDDLDVRLGFDLCAQERDFIHKRKKVVAAALKDILQLE
EGLQDDEVPVVAIMTTGGGTRALTAMYAHLLSVQEINVLDCVSYITGLSGTTWTMSNLYG
DPDWSQKDLKETLNDARKHVLKNKLFTCFAPDCLKYYLKELCQREREGHQICFTDLWGLI
IETMLHEKEDCHKLTDQQQALNQGQNPLPIYLSLNVKDKISDQDFREWVEFTPYEVGFPK
YGAFIRAEDFGSEFFMGRLMKKMPESRICFLEGIWSSVFSLNLMDAWYISVHSEDFWHKW
TRDKITDIDDETLFPPRPNELDTRVVCPPDSFSDVFRDVAMLRPAASEIHNFLKGLQMNN
NYLESEFSKWKDCELDSQPSRLTVATDYLILIDTAFAFATSYPPLLRPERKVDVILHFNY
SSGSQTGPLKEASKYFAKQGIPFPRKVPDDQETPHLKECYIVGDKESPETPIVVFFPLVN
DTFRDYKAPGVKRSPSEMAEGDVDVANTCGPYYINNLSYSEEDFDKLVNLSYYNVQNNKD
LILQALCTAVERKKQHKKEQPLQKIPVRDGVYVSDREGTQHLTDCPAPGNMK
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggggagctcggactcctgctggcaccggcaacgttgccaccctccttatcgca
acaccctttgtatttgaacagacccatgagaggatttttcattcatatgctattagggct
tttgcccaagcttcacattatgatggggaggcactggcaaccgtggagcctaacacccag
gtgccacctgcagcacctgctcttaatacagcagcaaccntcatggcatcaacctctgcc
ttccctcagcattcaagcggcaaatcaagccccatggaacatgaaggaagaaaatggatg
atgcgctacacagccctgagcgatgctgatgctaagcaggaagaaatgtcaccttactcg
ctgctcactgtaagaatcataaagttgaaaaatgctcatcaggcagattttttaagccag
tctgattgctacgtgagcctctggctgccgactgcttcagatgaaaaataccacaccaaa
acaatcaaaaactgcagcaatcccatgtggaatgagacattctacttccggatacagagg
caagtcaagaatattctggaaattactgtttctgatgacgacatcattcgtgacgatgac
catgcaattgtgctttttgatgtagctaaaatcccccttgnnnnnnnnnntttgatacac
cttgacatccattctctcccctcagattaaagaggcatggaggagctggaagttgagttt
ctgttggagagcatccggggccctcctgaaaccatcatcacaaatggggcaatagtgtgt
cgtgaagtagcctgcttggaagttcatttggacagcaggatgaaaaagaagcatttttca
gggaatgagctaacatttacagtgaaaggatcctttgaagaaacccagagaatttcagtg
ggctgtgcctcccactcccctctcccagatcccaccttcttccattacgccaaatacaag
cagccctccctggatatcgcactcacaaagaagaggaggcttcccaccctttgtgcttgt
gtgccatgcggagcgaggaggaggtgcagcgtccccctgactctccctctgaagtcactc
ccctctgagggggaagcggtcagtgagcacagaaaatttgatttgcactttaaggtgaaa
aaatgccaggatgacctcgatgtacgcctggggttcgacctgtgcgcccaggagcgggac
ttcattcacaagaggaagaaggtggttgcggcggctctgaaggacattctgcagctggag
gagggcttgcaggatgacgaggtacctgtggtggcaatcatgacaacaggtggtggaacc
agagctctgacagccatgtacgcccaccttctcagtgtgcaggaaattaatgtcttggac
tgtgtctcatatatcactggtttatccggtacaacatggaccatgtcaaacttgtatgga
gatcctgattggtcccaaaaggatcttaaggaaacactcaatgatgcccgaaagcatgtg
ctcaaaaataagttatttacttgttttgcccccgattgtctgaaatactatttgaaagag
ttgtgccagagggaacgggaaggacatcagatatgtttcacggatctgtggggactcata
attgaaaccatgttacatgaaaaggaggactgccataagctcacagatcagcagcaggca
ttaaatcaaggtcagaatcccctgcccatctacctctctctcaatgtgaaggataaaatc
agcgaccaggattttagagaatgggtggaattcaccccttatgaggtaggattcccgaaa
tacggcgccttcattcgcgcagaagattttggcagtgagttcttcatgggtcgcctgatg
aagaagatgccagaatccagaatctgctttttggaagggatctggagcagtgtattttcc
ttgaatcttatggatgcctggtatatatctgttcattcagaagacttctggcacaaatgg
acccgagacaaaattactgacatagatgatgaaaccctgttccctccaaggccaaatgag
ctggatactcgagtggtttgcccccctgacagcttctcagacgttttccgagatgttgcc
atgttacgtccagcagcttcagaaatccacaactttctgaagggcctccagatgaacaac
aactacctagagagcgagttttccaaatggaaagactgtgagcttgactctcagcccagc
cgcctgacagtagcaacagactacctcatcctgattgatactgcatttgcctttgccacc
agttacccaccccttctgagaccagaaaggaaagtggatgtcattttgcatttcaactac
agttcaggttcccagacagggcccctgaaggaagcctctaaatactttgcaaaacaggga
atccctttccctaggaaggtgccagatgatcaggaaaccccacacttgaaggagtgctat
attgtcggtgacaaggagagcccagaaacacctattgtggtatttttccctctagtaaat
gacaccttcagggactacaaagcgcctggtgtgaaacgtagtccctcggagatggcagag
ggtgacgttgatgttgccaatacctgtggtccatattacattaacaatctgagttattca
gaggaagactttgacaaactggtgaacctaagttactacaatgtccagaacaataaagat
ttgatcctccaggccttgtgtactgctgtggagcggaaaaagcagcataagaaagagcaa
ccactgcaaaaaatacctgtcagggatggtgtatatgtgtctgatagagagggaacccag
catttgactgactgcccagcaccagggaatatgaaataa

DBGET integrated database retrieval system