KEGG   Falco cherrug (Saker falcon): 102057776Help
Entry
102057776         CDS       T02911                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00561  Glycerolipid metabolism
fch01100  Metabolic pathways
Module
fch_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102057776 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fch01002]
    102057776 (MGLL)
Enzymes [BR:fch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102057776 (MGLL)
Peptidases [BR:fch01002]
 Serine Peptidases
  Family S33
   102057776 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 PGAP1 Thioesterase Abhydrolase_5 LIDHydrolase DUF2048 DUF1350 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 102057776
NCBI-ProteinID: XP_005432663
Position
Un
AA seq 290 aa AA seqDB search
MKTGHSSRMPEESSPKRSPQNIPYKDLPHIINADGQHLFCRYWKPAATPRALVFIAHGAG
EHCGRYDDLAQRLTGLNLFVFAHDHVGHGQSEGDRMVVSDFHVFIRDSLQHIDLMKKEHP
GLPILILGHSMGGAISILTASERPSEFSGMLLISPLVVASPEVATPIKVFAAKVLNFVLP
NLSLGSIDPNAISRNKKEMESYTSDPLVYHGGMKVSFVIQLMNAIARIERALPKLTLMDT
VQSQDKTLKVYEEAYHALHKELPEVSTSVFTEILTWIAQKVSAAGENSHT
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggtcattcttccagaatgccagaggaaagttcaccaaagcggagtcctcaa
aacatcccgtacaaggacctgccccatatcatcaatgctgatgggcagcatctcttctgc
aggtattggaagccagcagcaactcccagggccctggtgtttatcgctcacggcgctggg
gaacactgcggccgctatgatgacttggcccagaggctgacaggactcaacttgtttgtt
tttgcccacgaccatgttggccacgggcagagcgagggtgatcgtatggttgtctcagat
ttccacgtcttcatcagggacagcttgcagcacattgatctcatgaagaaagagcaccct
gggctgcccattctcattctggggcactccatggggggagccatctccattctgacagct
agtgagagacccagtgagttttcaggaatgctgttaatctctcctttagtggtagccagc
ccagaagtcgccactcctatcaaggtttttgcagcgaaagtgctcaattttgttctccca
aacctgtcgctgggatcgatagatccaaatgcaatttcccggaacaagaaggagatggag
tcttacacatccgatcccttggtctaccatggcggcatgaaggtctccttcgtcatccag
ctgatgaatgccatcgccagaattgagcgagctctgcccaagctgactttaatggacaca
gtgcagagtcaggacaaaaccctcaaggtgtatgaggaagcctatcatgccctccacaaa
gagctgcccgaggtttctacctctgtcttcacagaaatactaacatggatcgcccagaag
gtctcagcagctggggaaaacagccatacttaa

DBGET integrated database retrieval system