KEGG   Falco cherrug (Saker falcon): 102058269Help
Entry
102058269         CDS       T02911                                 

Gene name
PIK3C2A
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha isoform X4
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00562  Inositol phosphate metabolism
fch01100  Metabolic pathways
fch04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102058269 (PIK3C2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102058269 (PIK3C2A)
Enzymes [BR:fch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     102058269 (PIK3C2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 102058269
NCBI-ProteinID: XP_005442824
Position
Unknown
AA seq 1694 aa AA seqDB search
MAQISSSNGFKQRSSPSVAAARSKDVDKEEALQMEAEALAKMQKERGVAGNKQTFHSLSS
TRQKAQTHSKQDHDLMVFPESDAKSMEDKLSTVDIEKLTHAELEKLLLDDTFESSKVPTL
PVSPILSPSVSSQFYLGPMSQRRQWMPGTPAPVTCTLPPIYPSASYTKQTGVFQNGFHPS
MSSYHSREPIYLGLPRQLQYISYPPAAITPFHPQGSLPIYPPVPVLTPEMAKVFDKIAST
SEFLKNGKSSTDLEVTAIKSAVSNLPPSESCRDVSKFDWLDLDPLSKPKVDSVETLNVEN
DGERALSMTAEDPWDAVLLEEKLLVTCHLERKVNGKSSGATVTRSQSLNMRTTQLAKLQG
QTSQKDNGTTGMLSGNVLLQEIEGQNQELSAFSQAITKLRTKFPYTNRQTNPGFVLSPIM
LQRSISGESASIKVSIEIEEFQQPVTFTCDVSSPVELIIMQALCWVHDDLNEVDIGSYIL
KVCGQEEVLQNKHCVGSHEYIQSCRKWDTEIKLQLLTHSVICRDLARTEDDDSTPIHLTK
HLYKVEKPFREPIIRSSIEELLDVYQKQVNIALKNENQHKAVDHVIKTVRKICSTLDCVE
TPAITESVKKLRRAVNLPRTKNAEVSLKRGDDTSKSSSVSLQPENPLKVSIDQLTRAVEA
LLQLHVNSCSSSAAISSKDSKSTKEAWTATEHLQFTIFAAHGISPGWVSNYEKYYLICSL
THNGKDLFKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLCLTLFGILNQSSG
SSPDSNKQRKGPEILGQVSLPLFDFRRLLTCGTKLLQLWTSSHPRLVSGMASKKGNTERI
VLQIDFPSHAFDIEYKIPQAAKTTVHHTIETLEKPLRERLLTILSKDNTIGLSKEDKEFL
WEKRHYCHSHTSSLPKILVSAPHWDWASLPEIYSLLHQWPPLSPLAALELLDSKFADQEV
RNTAVNWIETLSDDELTDFLPQFVQALKYETYLDSALVKFLLARALGSIRIAHYLYWLLK
DTLYDTKFGVRYEQILGAFLSICGKRLREELEKQTRLVQLFGMVAERVKQTSGSARQAAL
QNGMERVQLFFLKNKCRLPLNPSLVAKELNIKACSFFSSNAVPLKVALINADPLGEEINV
MFKVGEDLRQDMLALQMIKIMDKIWLQEGLDLRMVIFKCLSTGKDRGMVELVPASDTLRK
IQVEYGVTGSFKDKPLAEWLRKYNPTEEEYEKASENFIYSCAGCCVATYVLGICDRHNDN
IMLRNTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDL
CCQAYNLIRKHASLFLNLLSLMLSSGLPELSGVQDLKYVQDALQPQTTDAEATIFFTRLI
ESSLGSVATKFNFFIHNLAQLRFSGLPSNDEAILSFSAKTYSLKQDGRIKQVSVFTYQKR
YNPDKHYIYVVRVLREGQVEPTFVFRTFDEFQELHNKLGILFPLWKLPGFPNKMVLGRTH
IKDVAAKRKVELNSYIQSLMNSSSEVAECDLLYTFFHPLLRDEKVEGIDGIARPTDVSPS
SPTSGKVGGEVKLSISYRNSTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDTHKTSKRKT
KISRKTRNPTFNEMLVYSGYSMETLKQRELQLSVLSAESLRENFFLGGITLSLKDFNLSK
ETINWYRLTAVPYL
NT seq 5085 nt NT seq  +upstreamnt  +downstreamnt
atggcccagatatccagtagcaatggatttaaacagcgctcatcaccttctgtggcagct
gcaaggtcaaaagatgtggacaaagaggaggcattgcagatggaagctgaggcattagct
aagatgcagaaagaaagaggtgtagctggtaataaacaaacttttcattctttaagtagc
accagacaaaaagcacagactcatagcaaacaggaccatgatctcatggtgtttccagag
tctgatgccaagagcatggaagataaactaagtactgttgacatagagaagcttacgcat
gctgaactagagaaactgttgctggatgacacttttgaatctagtaaagtacctacatta
ccagtaagtcctattttgagcccatctgtgtcttcacaattttatcttgggcctatgagt
caaagaagacagtggatgcctgggacaccagcacctgtgacatgcactttacctcctatt
tacccctcagcttcttacacaaaacagactggtgtgtttcagaatggattccatccaagt
atgtcctcctatcactctagagaacctatttatcttggtcttccaaggcagttgcaatac
atttcatacccaccggcagctattacacctttccatccacaaggaagcctacctatatat
cctcccgtaccagtacttacaccagaaatggcaaaggtgtttgacaaaattgcaagcacc
tcagaatttctgaaaaatgggaagtcaagcacagacttggaagtgactgctataaagtct
gcagtttctaacctaccaccctcggaaagctgcagggatgttagtaaatttgattggtta
gatttggatcctctaagtaaaccgaaagtggatagtgtggagactttaaatgtagagaat
gatggagagagggctttgagtatgactgctgaagatccatgggatgctgtgctgttagaa
gagaagctgttagtaacttgtcatctggaaagaaaagtaaatgggaaatcatctggagca
acagttacgaggagccagtccttaaacatgcgaacaactcaacttgcaaagctacagggc
caaacatcacagaaagacaatgggaccactggtatgctgtcaggaaacgtgcttctccaa
gaaattgaagggcagaatcaagaactgtcagctttttctcaagcaattacaaaattgagg
accaagtttccttacactaatcggcaaacaaatccaggctttgtgctgagtccaatcatg
ctgcaaagaagtataagtggggagagtgccagtatcaaggtttctatagaaattgaagaa
ttccagcaaccagtaacttttacgtgtgatgtgagttcccctgttgagcttataataatg
caggcgctttgctgggtgcatgatgacttgaatgaagtggacattggcagctatatcctg
aaagtctgtggccaggaagaagttttacagaataagcactgtgttggaagtcatgaatat
attcagagctgtcggaagtgggatacagaaatcaaactgcagctcttgacccacagtgta
atatgcagagatctagcacgaacagaagatgatgacagcacacccatacatctaaccaaa
cacctctacaaagtagaaaagcctttcagagaacctattataaggtcttctattgaagag
cttcttgatgtgtatcagaagcaagtcaatatagctcttaaaaatgagaaccagcataaa
gcagtagatcatgtaattaagactgtcagaaaaatctgttccacattggattgtgtagag
actcctgcaataacggaatcggtaaagaagctaaggagggctgttaatcttccaaggact
aaaaatgccgaggtatccttaaaacgcggtgatgacactagcaagagctcatctgtttca
ctgcagcctgaaaaccctctgaaagtgagtatagaccagttaacaagagcagttgaggcc
cttctgcaactccacgtgaattcatgtagcagttctgcagcaatttcttcaaaagatagt
aagagtaccaaggaagcatggactgccacagaacatctccagttcacaatatttgctgct
catggaatttctcctggttgggtatcaaattacgagaaatactacttgatttgttctctg
acccataatggaaaagatctgttcaagcctatccagtccaagaaggttggcacatacaag
aacttcttctacttgattaaatgggatgaactaataattttccccatccaaatttcacag
ctgcctttagaatcagtcttatgtctgactttgtttggaatcctaaatcaaagtagtggg
agttctcctgactcaaataagcagagaaagggcccagaaattttgggtcaggtttctcta
cctctttttgattttaggcggttgttaacttgtgggacaaagcttttgcaactgtggacc
tcatcacatccgcgtcttgtgtcagggatggccagtaagaaaggaaatacggaaagaata
gttttgcagattgatttcccatcccatgcttttgatattgaatataaaattcctcaagca
gcaaagaccactgtgcatcataccatagaaacattagaaaaaccactgagagaacgtctc
cttaccattctctctaaggataataccattgggctatcaaaagaagacaaagaatttttg
tgggagaagagacattactgtcatagtcatactagtagcctaccaaaaatactggttagt
gcccctcactgggactgggcaagtcttccagaaatatattcgctacttcaccagtggcct
cctttatcacccttggctgcactggaactacttgattcaaagtttgctgaccaggaagta
cgaaatacagctgtgaattggatagagacattaagtgatgatgagttaacagatttcctc
cctcagttcgtacaggcattgaagtatgaaacctaccttgacagtgctcttgtcaaattt
cttttggctcgggcattgggaagcattcgaatagcacactatctatactggcttcttaag
gatacactgtacgatacaaagtttggtgtaaggtatgagcaaattcttggagcttttctt
tccatctgtggaaaaaggctgagggaagagctggagaagcagaccagactggtgcagctt
tttggaatggtggcagaaagagtaaagcaaactagtggatctgctcggcaggctgccttg
caaaatggtatggaacgtgtgcagttatttttcttgaagaacaaatgccgtctgcctctc
aatcccagtcttgtggcaaaagagttaaatattaaggcatgttctttcttcagctccaat
gcagtaccactgaaagttgcactgataaatgcagaccctctgggagaagaaattaatgtg
atgtttaaggttggggaagatctgagacaagatatgttggctttacaaatgattaagatt
atggataagatttggctgcaggagggactggatctccggatggttatcttcaagtgtctc
tcaactggaaaagacagaggcatggtagagcttgttcctgcttcggatacacttaggaaa
attcaagtggaatatggagtgacaggttcatttaaagacaaacctctggcagaatggttg
cgaaagtataatcctactgaagaggaatatgaaaaggcttcggaaaacttcatttactcc
tgtgcaggatgctgtgtagctacttatgtattggggatttgtgaccgccacaatgataac
ataatgctccgaaacacagggcatatgtttcacattgactttggaaaatttttgggccat
gcgcagatgtttggtagctttaaaagggatcgagctccttttgtgctaacatcggatatg
gcttatgtcattaatggtggtgaaaaacccactatccgctttcagttgtttgtggatctc
tgttgtcaggcttacaatttgataagaaaacatgcaagcctcttccttaacctactgtca
ttgatgctttcttctgggttaccagaactaagtggggttcaggacttgaagtatgtccag
gatgctctccagccccaaacaacagatgcagaagctaccattttctttacaaggttgatt
gaatccagtctgggaagtgttgccacaaagtttaatttcttcattcacaatttggcccag
ctgcgtttctcaggtctaccttctaatgatgaagccatcctctcattttctgctaaaaca
tattctcttaaacaagatggcagaatcaaacaagtgtctgtgtttacatatcagaagaga
tacaacccagataaacattatatctacgtagtgagagttttgagagaagggcaagttgag
ccaacatttgtcttccgaacatttgatgagttccaggagctccacaacaaacttggcatt
ctctttcctctctggaagttaccaggctttcccaataagatggttctgggaagaacacat
ataaaagatgtagcagctaaaagaaaagtggagctcaacagctacatacagagtctgatg
aacagttcttcagaggtggcagaatgtgatcttctttatacatttttccatccattactt
cgtgatgagaaagtggaaggaatagatggaatagccagacctacagatgtaagtccatca
agtcctacctcaggcaaagtgggaggagaagtgaagctatccatatcatatagaaatagc
actctgtttatcatggtgatgcacattaaagacctggttacagaagatggtgcagatcca
aatccctatgtaaaaacatacttacttcccgatacacacaagacgtccaaacgcaaaacc
aaaatctcccggaagacaagaaatccaactttcaatgaaatgcttgtgtacagtggatac
agcatggagactctgaaacagagagaacttcagttaagtgtgctcagtgcagaatcgtta
cgtgagaactttttcttgggtggaattacactctcgctaaaggacttcaatttgagcaag
gagactattaactggtatcgactaactgctgtaccctatctgtga

DBGET integrated database retrieval system