KEGG   Falco cherrug (Saker falcon): 102058274
Entry
102058274         CDS       T02911                                 

Gene name
AFF3
Definition
(RefSeq) LOW QUALITY PROTEIN: AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fch03021]
    102058274 (AFF3)
Transcription machinery [BR:fch03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102058274 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int MACPF
Other DBs
NCBI-GeneID: 102058274
NCBI-ProteinID: XP_027669210
Position
Unknown
AA seq 1103 aa
MDSFDLALLQEWDLDSLCVYEPDRNVLRRKEWERRNQETQQEDGAFNMSYSLFSEPYKTN
KGDELSNRIQNTLGNYDEMKDLLTDRSNQSHLVGVPKPGVPQTSLPKPDEHLIADSRPPP
PPPISSTTSSTPAALSAQQSKSTTMGWQKAGHNATSDGQQRASKHGHRSLESHKGDFKLV
NQKSSLEKLKRYASSPTSSSSNTAQQSSLRATLGDNVNRVQQPAKLNCSSEGGAQAQERP
AKHGGGHCVQNFPPSLASKPSLVXAYVRPMDGQDQAPDESPKLKLPAETTKSYRGVPSNK
PDSSRTKSKIAKFSIPKQEEDSGTGDNSCIEEILREMTHSWPPPLSAIHTPGKAEQSKFP
FPNKESQQGSTGHSNTRKSDVEPKSPEKNATHASMLEDDLKLSSDEEENDQQAAQRSALR
VLSDSLVVPQSNTRAPGLSSKGSSSSSSSESETSSESDSESESSSSESDGSKPSHYSSPE
PEPPSSNKWQLDKWLNKVTPHKAPILTHHDGPALEAHPYYGRVKAERQESEKTLATGPAE
HRKSKEFIETESSSSSSSSDSGSESEREERPLPKVPAVAGSEPRAKDAGTGTANKPHGGC
SAFGSINARTSSEIAKELEEQFYTLVPFGRNELLSPLKDSDEVKSLWVNIDLALLSRIPE
RLPEEPLAMSAGANQAASLPQGSSADPPAEKGLPKSRRKRKCENEEECRDIKKTHLERES
SSRLAASAQSITAANHCNMNENSLAIPINKNEKMLRSPISPLSDASKHKYSNDDLTSSSR
PNGSSLLPSISSTKKHKGEIQSQPHSGDFNKAIHVNSENVLLCNKPQSQTEPWSPLSSTP
RDCRRTKLIFDDMPHNADYFMQEAKRKKHKADAMVEKFGKALNYAEAALSFIECGNAMEQ
GPMESKSPYTMYSETVELIRYAVRLKTHSGPSATPEDKQLAALCYRCLALLYWRMFRLKR
DHAVKYSKALIEYFKNSSKAAQNPSPWGASGKSTGTPSPMSPSPSPVSSVGSQGSTGAPS
PSPIISIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENRDFFNDLDALMGPITLHS
SMEHLVQYTQQGLHWVRNSAHLS
NT seq 3312 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagctctccttcaggagtgggacctggactctctgtgtgtctat
gagccagatagaaacgtgctgcgaaggaaagaatgggaaagaagaaatcaggagacccag
caggaggatggcgcgtttaacatgagttactccctcttcagtgaaccgtacaagactaat
aagggggatgagctctcgaatcgcatccagaacaccctgggcaactatgatgaaatgaaa
gacttgttaactgaccgatcaaaccagagtcaccttgttggggttccaaaacctggggtt
cctcagacgtctctccccaagcccgatgaacatcttattgcagactccagaccaccgcct
cctcctcccatttcaagcactacttcttccacaccagcagccctatctgcccagcagagc
aaaagcaccacgatgggttggcagaaggcggggcacaatgccacttcagatggccagcag
agagcaagcaagcatgggcaccggtcgctggagtcacacaagggtgacttcaaactggtg
aaccagaaatccagtctggagaaactaaaacgctatgcatcgagtcccacctcttcctcc
tccaatactgcccagcaaagctcgctgagagccacactaggagacaatgtcaacagagtg
cagcagccagcaaagctcaactgtagctcggaaggaggagctcaagcacaagagaggccg
gcaaagcatggtggcgggcactgcgttcaaaacttcccaccctcgcttgcttcgaagccc
agcctggttnncgcttatgtaaggccaatggacggtcaagaccaggctcctgatgagtct
ccaaagctgaagctaccagcagagacaaccaagtcatataggggagtgccttctaataag
cctgattcgtccaggaccaagtcaaagatagccaagttcagcattcctaagcaagaagag
gacagtggaacaggagataacagctgcattgaagaaatattgcgggagatgacccattca
tggcccccaccgttgtcagctattcatacaccaggaaaggcagaacaaagcaagtttccc
ttcccaaacaaggagtcacaacagggatctacaggacacagcaatacaaggaaaagtgat
gtagagccaaagagtccagagaaaaacgcaacccatgcatcaatgctagaagatgacctc
aagttaagcagtgacgaagaagagaatgaccagcaggcagcacagagatctgctctccgc
gttctatctgacagcctggtggtgccgcagtccaacaccagagccccaggactctccagc
aaggggtcgagcagcagcagctccagtgaatcggagaccagctcagagtctgactcggag
agtgaaagcagctccagtgaaagtgacggcagcaagccctcgcattattccagcccagag
cctgagccaccctcatccaacaagtggcagctggacaagtggttgaataaagtcaccccg
cacaaagcacccatcctgacccaccatgatggcccggcgctggaggctcatccctactat
ggccgtgtgaaggcagagcggcaggaaagcgagaagaccctggccactggcccagccgag
caccgcaaatcaaaagagttcatcgagactgagtcttcgtcctcatcatcctcctccgac
tcgggctctgagtccgagcgggaggagcgcccgctgccaaaggtgccagcggtggccggg
tccgagccgcgtgccaaggatgcggggactggcaccgccaacaaaccccacggcggctgc
agtgcctttggctccattaatgccaggactagtagtgaaatagcaaaggagctggaggaa
cagttttacaccctagttcctttcggtaggaatgagctcctgtctcctctgaaagacagt
gatgaggtaaaatcgctgtgggtcaacattgacttggctcttttgtccaggattccagag
cgtttgcccgaagagccgctggccatgagcgccggagcaaaccaagcggccagcctcccg
cagggtagtagtgctgaccccccagcagagaagggtttaccgaaatctagaaggaaacgc
aagtgtgagaatgaggaagagtgcagagacatcaagaagactcacttagagcgagagagt
tcttcacgattagctgcctctgctcaaagcatcacagcagcaaatcactgcaatatgaac
gaaaatagcttggcaataccaataaataaaaatgagaaaatgcttcggtcacccatctct
cctctctctgatgcatcaaaacacaaatactccaacgatgatttaacttcctctagcaga
cctaacggcagcagtctattaccttccatctcctccaccaaaaaacataagggtgaaatc
cagtcacagccacattccggagacttcaataaagcaattcacgtcaattcagaaaatgtt
cttctctgcaataagccacagtcccaaacagagccttggtcacctctgtccagcacgccc
agggactgcagaaggacaaagcttatctttgatgatatgccacacaatgcagattacttt
atgcaggaagctaaacggaagaagcataaagcagatgcaatggtggaaaagtttggaaag
gcactgaattatgcagaagcagcactatcatttattgagtgtggaaatgcaatggaacaa
ggcccaatggaatctaaatccccttacacaatgtattcagaaacagttgaactcatcagg
tatgcagtgagactaaaaacccactcaggccccagcgccacaccagaagacaaacagctg
gcagcattatgttaccgctgcctggcccttctgtactggaggatgttccgactcaagaga
gaccatgcagtcaagtattcaaaagctcttattgagtatttcaagaattcatcaaaagct
gcccagaatccgtctccttggggtgccagtggaaagagcacaggaactccatcacccatg
tcccctagcccttctccagtcagctctgtgggttcccaggggagcacaggggccccttct
ccatctcctatcatcagcatcccgcagcgcattcatcagatggctgccaaccacgtcagt
atcaccaacagcatcctgcacagctatgactactgggagatggctgataacctggccaag
gaaaacagagatttttttaatgacctggatgcattgatgggacctatcactttgcacagc
agtatggagcatttagttcagtatactcaacaaggacttcactgggtgcggaatagcgct
cacttgtcataa

DBGET integrated database retrieval system