KEGG   Falco cherrug (Saker falcon): 102058498Help
Entry
102058498         CDS       T02911                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fch04131]
    102058498 (DOCK7)
Membrane trafficking [BR:fch04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    102058498 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 102058498
NCBI-ProteinID: XP_027662809
Position
Unknown
AA seq 2044 aa AA seqDB search
MDPHVRDCVRSYTEDWAIVNRKYHKLGTGFNPNTLDKQKERQKGLPKQIFESDEAPDGNS
YQDEQDDLKRRSMSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDHHNEDQRK
SSRHKELFALHPAPDEEEPIERLSVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALY
DVKEKKKISENFYFDLNSEQMKGMLRPHVPPAAISTLARSAIFSITYPSQDVFLVIKLEK
VLQQGDIGECAEPYMIFKESDAAKNKEKLEKLKCQAEQFCQRLGKYRMPFAWTAIHLMNI
VSSAGSLERDSTEVEVGTGERKGSWSERRNSSIVGRRSLERTTSGDEACNLTSFRPATLT
VTNFFKQEGDRLSDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPEL
LQVKLYPDSRVRPTREILEFPARDVYVPNTTYRNLLYVYPQSLNFANRQGSARNITVKVQ
FMYGEDPSNAMPVIFGKSSCPEFSKEAYTAVVYHNRSPDFHEEIKIKLPATLTDHHHLLF
TFYHVSCQQKQNTPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLP
GMKWVDNHKGVFNVEVVAVSSLHTQDPYLDKFFALVHALDEHMFPVRIGDMRIMENNLEN
ELKSSISALNSSQLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRL
HKNLDGNQDQHGRNSLLASYIYYVFRLPNTYPNSPSPGPGGLGGSVHYATMARSAVRPAS
LNLNRPRSLSNSNPDISGTPTSPDDEVRSIIGSKGLDRSNSWVNTGGPKAAPWGSNPSPS
AESTQATDRSCNRMSSHTETSSFLQTLTGRLPTKKLFHEELALQWVVCSGSVREAALQQA
WFFFELMVKSMVHHLYFADKLDAPRKNRFPERFMDDVTALVSTIAGDIVSRFQKDTEMVE
RLNTSLAFFLNDLLSIMDRGFVFALIKTCYKQVSSKLYSLTNPSNLASLRLDFLRIICSH
EHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAG
LVLTELAVILDPDAEGLFGLHKKVINMVHNLLSSHDSDPRYADPQVKARVAMLYLPLIGV
IMETVPQLYDFTESHNQRGRPSCVAVDDYESEGGSMISQTVAMAIAGTSVPQLTRPSSFL
LTSSSGRQHSTFSTESSRSLLICLLWVLKNADESVLQKWFTDLSVLQLNRLLDLLYLCVS
CFEYKGKKVFERMNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFG
SQENLRWRKDMTHWRQNTEKLDKSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVT
ESKESILGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRL
LRHCSSSISTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEYLR
RSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIA
KGYQNSPDLRLTWLQNMAGKHSERSNHAESAQCLVHSAALVAEYLSMLEDRKYLPVGCVT
FQNISSNVLEESAVSDDVVSPDEEGICSGKYFTEAGLVGLLEQAAASFSMAGMYEAVNEV
YKVLIPIHEANRDAKKLSTIHGKLQEAFSKIVHQSTGWERMFGTYFRVGFYGTKFGDLDE
QEFVYKEPAITKLAEISHRLEGFYGERFGEDVLEVIKDSNPVDKCKLDPNKAYIQITYVE
PYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIK
TRINVIHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGP
LEVAQVFLSEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERN
YHRLKEALQPLINRKIPQLYKAVLPVTCHRDSFXXXXXQQDEPSQNGYLNKLKTKIKWHL
ELRF
NT seq 6135 nt NT seq  +upstreamnt  +downstreamnt
atggacccccatgtgagggactgtgtaagaagttacacagaagactgggcgattgtgaac
agaaaataccacaaactgggaactggatttaatcccaacaccttagacaaacagaaggag
aggcaaaaggggctccccaaacagatctttgagtctgatgaagctccagatggcaacagt
taccaggatgaacaagatgaccttaaacgacgttcaatgtcgattgatgatactccccgg
ggcagctgggcatgcagtatttttgatctgaagaactcccttccagatgctcttctccca
aacctactggaccgaaccccaaatgaagagattgaccaccacaatgaagatcagaggaag
tccagtaggcataaggagctttttgcactacatccagcaccagatgaggaggagcctata
gaacgacttagtgtccctgaagtacccaaagaacactttggccaaagactcctggtgaag
tgtttgtcccttaaatttgaaatagaaattgagcccatttttgcaagtttggccttgtat
gatgttaaagaaaagaaaaagatttcagaaaatttctactttgatttaaactctgaacaa
atgaaaggaatgcttcgtccacatgtcccccctgctgctatatccacactggccagatct
gccatcttttctatcacttacccctctcaagatgtctttctggtaataaagctggaaaaa
gtattacagcagggagatattggggagtgtgcagagccttatatgatttttaaagaatct
gatgcagcaaagaataaagaaaagttggaaaaactgaaatgccaagcagagcagttttgc
caaagactaggcaagtatcgcatgccttttgcctggacggccattcatttaatgaacatt
gtgagcagcgctggaagtttggaaagagattccacggaagtagaagttggcacaggagaa
cgtaaaggatcgtggtcagagaggcggaattccagtatagtcggaaggcgttcgttagag
agaaccacaagtggggatgaggcttgcaatttgaccagttttagaccagctactctgaca
gtgacaaacttctttaaacaggagggtgatcgcctgagcgatgaagatttgtacaagttc
cttgctgacatgagacggccatcatcagtgttacggagattgagacccatcacagcgcaa
ttaaagatagacatatctccggctccagagaatccccattactgtctaactccagagttg
ctgcaagtcaaactttacccagacagcagagttagacctacaagagaaatcctggagttt
cctgccagggatgtctacgttccaaataccacatacaggaatcttctttatgtttatcct
cagagccttaactttgctaaccgccaaggatctgccaggaatatcacagtaaaagtgcag
ttcatgtatggagaggaccctagcaatgctatgccggtcatctttggcaaatctagctgt
cctgaattttccaaagaagcctacacagctgtagtatatcacaacagatcacctgatttt
catgaggaaatcaagattaagcttccagccactttaaccgatcaccaccacctgcttttt
actttctaccacgtcagttgccaacaaaaacaaaacacccccctggagactccagtcgga
tacacttggataccaatgcttcaaaatggacggttaaagactggtcagttctgcctacct
gtttcattggaaaaaccaccacaggcttattcagtgctttctccagaggttccactccct
ggcatgaagtgggtggataaccacaaaggggttttcaatgtagaagttgttgctgtatca
tccctccacactcaggacccttatcttgacaagttctttgcacttgtccatgctctggat
gagcacatgttccctgtgcgaataggagacatgagaattatggaaaacaacttggaaaat
gaactgaagagcagcatttcagctctaaattcctctcaactggagccggtagtgcgattt
cttcatctcctgcttgacaaactgattcttctggtagtaagacctcctgtcattgcaggc
caaatagttaacctgggccaagcatcttttgaagcgatggcatcaatcataaacagactt
cacaagaacttggatggaaaccaggaccagcatggcagaaacagccttcttgcctcctat
atttattatgtttttcgcctaccaaatacctatcccaactcaccatcaccaggtcctggt
ggcttagggggatcggtgcattatgccaccatggctcgatctgctgtccgaccggcaagc
cttaacttgaaccgcccacggagcctcagtaacagcaacccagatatatctgggaccccc
acctcaccggacgatgaagttcgctcgatcattggcagtaagggtttagaccgctccaat
tcctgggtaaacactggtggtccaaaagcagccccatggggatccaaccccagcccaagt
gcagagtcaacacaggctacggatcgaagttgtaatcgtatgtcttcgcacactgagacg
tcaagtttcttacaaacattaacaggacgattaccaactaaaaagcttttccatgaagaa
ctggccttacagtgggtcgtgtgcagcgggagtgtgcgggaggcagccctgcagcaggcc
tggttcttcttcgagctgatggtgaagagcatggtacatcatttgtattttgctgacaaa
ctggatgcgccaagaaagaatcgttttcctgagcgtttcatggatgatgtaactgctttg
gtcagcacaattgctggtgatatagtctctcggtttcagaaggatacagaaatggtcgaa
aggctcaacaccagtcttgcgtttttcctcaatgacctgttgtctatcatggacagagga
tttgtttttgctcttattaagacctgctacaaacaggtgtcttcaaagctgtattcctta
acaaatccaagtaacctggcatctttaaggctggacttccttcgcatcatttgcagccat
gaacactatgtcaccttgaacttgccctgcagcttgctcacaccacctgcatctccatca
ccatctgtgtcttcagcaacttctcagagttctgggttctccacaaatgtccaagaccag
aagattgcaaatatgtttgaattgtctgtgcctttccgccaacagcattacttggccggg
cttgtgttaacagaactggctgtcattttagatcctgatgcagaaggtttatttggattg
cataagaaggtcatcaatatggtacacaatttactgtccagtcatgactcagatccacgg
tatgctgacccacaggtaaaggcccgggtggccatgctatatctacctctgattggcgtg
atcatggaaaccgtgcctcagctttatgactttacagagagtcacaatcagcgagggagg
ccaagctgtgtcgctgttgatgattacgaaagcgagggtggaagcatgataagccagaca
gttgccatggccatcgcaggaacatctgtcccgcagctcacccggcccagcagttttcta
ctcacctcatcgagtggcaggcagcactccaccttctcaacggagtccagccgcagcctt
ctgatctgtctcttgtgggtgctcaagaatgcagatgaaagtgtcttgcagaaatggttc
acagacctgtcagtgttgcagctcaatcgcctgctggatttgctttatctttgtgtatcc
tgctttgaatacaagggcaagaaagtatttgaaagaatgaacagtctgacattcaagaag
tcaaaagacatgagagccaaacttgaagaagctattttgggaagcataggggcaaggcag
gaaatggttcgaagaagcagaggacagctagagagaagtccttctgggagcgcgtttgga
agtcaagagaatttgagatggagaaaggatatgactcactggcgtcaaaacacagaaaag
cttgacaaatcgagagcagagatagaacacgaggcacttatcgatggaaatcttgcaacg
gaagccaatctgattattttggatacactggagatagttgtacagactgtttctgtgacg
gagtccaaagagagtatcctcggtggggtgctgaaagtgcttctgcacagcatggcctgc
aaccagagtgcactttatctccaacactgcttcgccacacagagggctttggtttcaaag
ttccctgagctgctgtttgaagaagagactgagcagtgtgcagatctttgcttgaggctc
ctgagacactgtagcagcagtatcagcacaatacggtcgcatgcaagcgcctctctttac
ctactgatgaggcaaaactttgagattgggaacaactttgccagagtgaaaatgcaagtg
actatgtctctctcatccctggtggggacatcccagaacttcaatgaagaatatttgcga
cgttccctgaagaccattttgacatatgctgaagaagatctggaactcagggagacaaca
tttcctgatcaggtccaggatctagtgttcaacctccatatgatcctctctgatacagtt
aaaatgaaggagcaccaggaagatccagaaatgctgattgacttgatgtacaggattgca
aagggctatcagaattcccctgacctgcgcctgacgtggctgcagaacatggctggaaag
cactctgagaggagcaatcatgctgagtcagcccagtgcctggtccactctgcagccttg
gtggctgagtatctaagcatgctggaagaccgaaaataccttcctgtaggatgtgttaca
tttcagaacatatcttccaatgttttggaagagtcagcagtttctgatgatgttgtatcg
ccagatgaagaagggatctgttctggaaagtattttacagaagctggtctggtgggattg
ctggaacaggctgcagcatctttctctatggccggcatgtatgaagcagttaatgaggtt
tacaaagtccttattcctattcatgaagctaatagagatgccaagaagctatctactatt
catggtaaactccaggaagcgttcagcaagattgttcaccagagtactggctgggagagg
atgtttggcacctacttccgggttggtttttatggaactaagtttggagacctggatgag
caagagtttgtttacaaggaacccgcgataacaaagttagctgaaatatcccataggctc
gagggattttatggagagcgatttggggaagatgtgcttgaagtgattaaggactcaaac
cctgtggacaaatgtaaactagatcctaacaaggcctacattcagataacctacgtggag
ccgtactttgacacatatgagatgaaggacaggataacttacttcgataaaaactacaac
ttgcggcgtttcatgtactgcacacccttcacgctggacggccgggctcacggggagctg
cacgagcagttcaagcgtaaaacgatcctgacgacgtcccacgctttcccttacattaaa
accaggataaacgtcattcacaaagaggagatcattttgacacccattgaagttgccata
gaggacatgcagaagaaaacacaggaattggcctttgcaacccaccaagaccctgcggac
ccaaagatgctgcagatggtgctgcaaggatcagtaggtaccacagtgaatcagggacca
ttagaagttgcacaagttttcttgtctgaaatacccaacgatccaaagctcttcagacat
cataacaaactacggctctgtttcaaagacttcacaaaaagatgtgaagatgctctgcgc
aagaacaagagcctgattggtccagaccaaaaggagtatcagcgagaacttgaaaggaat
tatcaccggttaaaggaagctctccaacctttgataaatagaaagatcccacagttgtat
aaggcagtgctgccggtcacgtgccacagagactccttcagnnnnnnnnnnnntcagcag
gatgagccttcgcaaaatggatatctaaacaagttaaaaaccaaaataaaatggcactta
gaattaaggttttga

DBGET integrated database retrieval system