KEGG   Falco cherrug (Saker falcon): 102058571Help
Entry
102058571         CDS       T02911                                 

Gene name
GPT2
Definition
(RefSeq) glutamic--pyruvic transaminase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00220  Arginine biosynthesis
fch00250  Alanine, aspartate and glutamate metabolism
fch01100  Metabolic pathways
fch01200  Carbon metabolism
fch01210  2-Oxocarboxylic acid metabolism
fch01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102058571 (GPT2)
   00220 Arginine biosynthesis
    102058571 (GPT2)
Enzymes [BR:fch01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     102058571 (GPT2)
Amino acid related enzymes [BR:fch01007]
 Aminotransferase (transaminase)
  Class I
   102058571 (GPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102058571
NCBI-ProteinID: XP_005444667
Position
Un
AA seq 423 aa AA seqDB search
MGQRPITFLRQVVALCTYPNLLDSPSFPEDAKKRARRILQGCGGNSLGSYSASQGINCIR
EDVASYIERRDGGVPADPDNIYLTTGASDGIATILKILVSGGGKSRTGVMIPIPQYPLYS
AAISELDAIQVNYYLDEENCWALDVNELRRSLNEAKAYCNPKVLCIINPGNPTGQVQNRK
CIEDVIHFAWEEKLFLLADEVYQDNVYSEGCQFHSFKKILYEMGPEYYNNVELASFHSTS
KGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPIPGEESYS
QFIKEKESVLNNLAKKAKLTEDMFNKVPGIHCNPLQGAMYAFPRIFIPSKAIEEAKTHKM
APDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKILLEKVKDFHIKFLE
KYA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgggacagaggccaatcactttcctccgtcaggtagtggcactgtgtacatacccaaac
ctgttggacagcccaagttttccagaggatgccaaaaagcgagccagacggatcttgcag
ggttgtggaggaaacagcttaggatcttacagtgccagtcaaggtataaattgcatccgt
gaagatgttgcttcatatattgaacgaagagatggaggtgttcctgcagatccagataac
atatatcttaccacgggggcaagtgatggtattgctacaattttaaagatcctggtctca
ggaggtggaaaatcccgaacaggagtgatgatccctataccacaatatcccttatattca
gcagccatatctgaactagatgctatccaggtgaactactatttggacgaagaaaattgc
tgggctctagatgtgaatgaacttcgccgttccttgaatgaagctaaggcatattgcaat
ccaaaagtcctctgcatcatcaaccctggaaatcccacaggacaggtccaaaacagaaag
tgcattgaagatgtgatacactttgcttgggaagagaaactttttcttctggctgatgag
gtttaccaggacaatgtgtactctgaaggatgccagtttcattctttcaaaaagattctg
tatgagatgggacccgagtactataacaatgttgagctggcctcttttcactccacctct
aagggatacatgggcgaatgtggctacagaggaggttacatggaggtcattaacttgcac
ccagaaattaaaggacagcttgttaagctgctttctgttcgcctttgtcctccagtctca
ggacaagcagcaatggatattgtagtgaatcctccaatacctggagaagaatcttattca
cagttcataaaggagaaggagtctgttttgaacaatcttgccaaaaaagccaaactaaca
gaagacatgttcaacaaagtaccaggaattcactgcaatccacttcaaggagctatgtat
gctttcccacggatctttattccttccaaagccattgaggaagcaaagactcataaaatg
gcacctgatatgttctattgcatgaaacttctggaagagaccggaatatgtgttgtacct
ggaagtggattcggccaaagagaaggaacctatcatttcagaatgaccattcttcctcca
gtagagaagctgaagatcctactggagaaagtgaaagacttccacataaagtttcttgaa
aaatatgcatga

DBGET integrated database retrieval system