KEGG   Falco cherrug (Saker falcon): 102058618Help
Entry
102058618         CDS       T02911                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00071  Fatty acid degradation
fch01212  Fatty acid metabolism
fch03320  PPAR signaling pathway
fch04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102058618 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102058618 (CPT1B)
   03320 PPAR signaling pathway
    102058618 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fch03029]
    102058618 (CPT1B)
Enzymes [BR:fch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102058618 (CPT1B)
Mitochondrial biogenesis [BR:fch03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102058618 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 102058618
NCBI-ProteinID: XP_027667307
Position
Unknown
AA seq 772 aa AA seqDB search
MAEAHQAVAFQFTVTPEGLDFHLSREAVRQLYLAGISSWKKRLVRAKNSFLTGVYPASPS
SWMVVVMATAGSFYCQVDPSLGMIARIRHCLPESRLLSYESRTMVSTVIFSTGAWLSAVL
LFRQALKLLLSYHGWMFEPHGKMSRSTRIWVALMKVLSIRKPLLYSFQTSLPKLPVPPVE
ATITRYLESVRPLMDDEKYSKMEALAKEFKEKTAPRLQKYLILKSWWTTNYVSDWWEQYI
YLHGRSPLMVNSNYYAMDFLYVTPSHIQAARAGNMVHAILMYRRKLDRGEIPPMMALGIV
PMCSYQSERMFNTTRIPGKETDTLLHLVDSKHLAVYHKGRFYKVWLYYGGQLLQPCDLEL
QFQRILDDPSPPQPGEERLAALTAGERVPWAEARARFFSHGKNKVSLDAIERAAFFLTLD
EEEHGYVAGKEGCMDTYAKSLLHGQCYDRWFDKSFKLVVYKNGKLGANAEHSWADAPIIG
HLWEFALATEKFQLGYTDRGHCRGEPNTQLAPPQRLQWDIPQECRDTIESSYRLAKALAD
DVDFCCFQFSEFGKGLIKKCRTSPDAFIQISLQLAHFRDKGCFCLTYEASMTRLFREGRT
ETVRSCTAESTAFVRSMGDARKTRAERQRLFKLAADKHQHMYRLAMTGAGIDRHLFCLYV
VSRYLGIQSPFLAQVLSEPWRLSTSQTPQQQLKMFDLNKYPDHVSSGGGFGPVADDGYGV
SYIIAGENLITFHVSSKFSSSETDSKRFGRNIRQAMLDIAELFDKPAEKAGK
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggctcaccaagctgtggccttccagttcactgtcacccctgagggcttggac
ttccacctcagccgcgaggctgtcaggcagctgtaccttgccggcatctcctcctggaag
aagcgcttggtccgcgccaagaacagcttcctgaccggcgtctaccctgcctccccctcc
agctggatggtggtcgtgatggccaccgctggctctttctactgccaggttgacccctcc
ctggggatgattgcccgcatccgccactgcctgcctgagagccgcctcctgagctatgag
agccggacgatggtgagcactgtgatcttctccaccggcgcctggctctctgctgtcctg
ctcttccggcaggcgctgaagctgctcctttcctaccacggctggatgtttgagccgcat
ggcaagatgagccgcagcaccaggatctgggtggcgctgatgaaggtgctgtcaatccgc
aagcccctgctctacagcttccagacctctctgcccaagctccctgtgccccctgtggag
gccaccatcacccggtacctggagtcggtgcgcccactcatggatgacgagaagtacagt
aagatggaggccctggccaaggagttcaaggagaagacagctccacggctgcagaagtac
ctgatcctcaagtcctggtggacaaccaactatgtgagcgactggtgggagcagtacatc
tacctgcatggccgcagcccactcatggtcaacagcaactactatgccatggattttctc
tacgtgacccccagccacatccaggctgctcgggcaggtaacatggtgcatgccatcctg
atgtaccgccgcaagctggaccgtggggagatcccccccatgatggcgctgggcatcgtg
cccatgtgctcctaccagtcggaacggatgttcaacacgacccgcatccctggcaaggag
acggacacgctgctgcacctggtggacagcaagcacctggctgtctaccacaagggccgc
ttctacaaggtctggctctactacggggggcagctgctgcagccctgtgacctggagctg
cagttccagcgcatcctggatgacccctcgcccccccagcctggcgaggagcggctggca
gcactcaccgctggcgagagggtgccctgggctgaggctcgagcccggttcttcagccat
gggaagaacaaggtgtcactggatgctatcgagcgggcagccttcttcctgacgctggac
gaggaggagcacggctatgtcgcgggcaaggagggctgcatggacacctatgccaaatcc
ctgctgcatggccagtgctatgaccgctggtttgacaagtccttcaaattggtggtctac
aagaacgggaagctgggggccaacgccgagcactcctgggctgatgcgcccatcattggg
cacctctgggagtttgcactggcaacagaaaaattccagctgggctacaccgatcgggga
cactgccggggcgagcccaacactcagctcgcccccccccagcgcctccagtgggacatc
ccccaggagtgccgtgacaccatcgagagctcgtaccgcctggccaaggcactggccgat
gatgtggacttctgctgcttccagttctctgagtttgggaaggggctgatcaagaagtgc
cggaccagccccgacgcctttatccagatctccctgcagctcgcacacttccgtgacaag
ggctgcttctgcctcacctacgaggcctccatgacgcgtctattccgtgagggccggaca
gagacggtgaggtcctgcaccgctgagtccaccgccttcgtgcgcagcatgggggatgcc
cggaagacccgagctgagcgccagcggctcttcaagctggcggccgacaagcaccagcac
atgtaccgcctggccatgaccggggccggcatcgaccgacacctcttctgcctctacgtg
gtgtcccgctacctggggatacagtcccccttcctggcccaggtgctgtcggagccctgg
cgcctctccaccagccagacaccacagcagcagctgaagatgttcgacctgaacaagtac
cccgaccacgtctctagtggtggcggctttggccccgtggcagatgatggctacggtgtc
tcctacatcatcgctggtgagaacctcatcactttccatgtctccagcaagttctccagc
tctgagacggactcaaagcgctttgggaggaacatccgccaggccatgctggacatcgct
gagctcttcgacaagccagctgagaaggcggggaaatga

DBGET integrated database retrieval system