KEGG   Falco cherrug (Saker falcon): 102059400
Entry
102059400         CDS       T02911                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
fch  Falco cherrug (Saker falcon)
Brite
KEGG Orthology (KO) [BR:fch00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fch01009]
    102059400 (AKAP5)
Protein phosphatases and associated proteins [BR:fch01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102059400 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 102059400
NCBI-ProteinID: XP_027658381
Position
Unknown
AA seq 525 aa
MVKAAKEIQMENPREAETHSTGATCSPSEERAEKPSMLCFKKRKKSCKKGLALKDVCEGA
SEEKSQCVSADQGEAKVSHQSRSSKGAWAAIKSLARPQRKQKSSSRKKVPSDSQVRLEVD
AEEGCVQGFPKKRASSRVKMPCVRFSRGKKKPSPSEAVEESEGSVQANEVMGISKKTSEE
PEDLAPADKSESFSPISAEEDQDTAKESAKSVGKSEPLTEPTPDAEEEDRDTAEESADSV
GKSQPLTEPTPDAEDQDTAKESADSVGKSQPLTEPAPDAEEHTDAEEHTECTAQSEITDS
ETVNETAQEKLQEESRPQTTACAEGGQVAPEPPVPKDQPSSTPETTELQEIPSIHKELPE
GDGSEKSIILPEERKAEETVMDFSQSAFKDDAGSLQGCSSHQVTLEANVGAGVSIVITVT
EAEDSDNTDSDQAYEPSPVLHRNKQKGNKKSSRSFDFGKKEGPEAGGDPQAEEKGLGDQG
HRTGEQYELLLIETASSLVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggtgaaggcagctaaggaaattcaaatggagaacccaagagaggcagagactcacagc
acaggggcaacgtgctccccgtcagaggaacgggcagaaaaaccctccatgctctgtttt
aagaagcggaagaagtcctgtaagaaggggctggccttgaaggatgtgtgtgaaggagcc
tcagaggagaaaagccaatgtgtcagcgctgaccaaggggaggcaaaagtttctcatcag
tcgcggtcctcgaaaggagcctgggcagccatcaaaagcctcgcaagacctcagaggaag
cagaaatcctcatcgcgaaagaaggtgccctccgattcccaagtgcggctggaggtggat
gctgaggagggctgtgtgcaaggcttcccaaagaaacgggcgagctcgagggtgaagatg
ccctgtgtacggttctccagaggcaagaaaaaacccagcccctctgaagcagtggaggag
tcggagggcagcgttcaagcaaatgaagtgatgggcatttcaaagaaaactagtgaagaa
ccagaggatttggccccagcagacaagtctgaatccttcagcccaatctctgcagaggag
gaccaggatacagcaaaggaaagtgccaagtctgttggaaaaagtgagcccttgacagag
cccacacctgatgcagaggaggaggaccgggatacagcagaggaaagtgctgactctgtt
ggaaaaagtcagcccttgacagagcccacacctgatgcagaggaccaggatacggcaaag
gaaagtgccgactctgttggaaaaagtcagcccctgacagagcccgcacctgatgcagag
gagcatacagatgcagaggagcatacagagtgtaccgctcagtcagagataactgattca
gagacagttaatgaaacagcccaggaaaagctgcaggaggagagccgaccccagaccaca
gcatgtgcagaaggcgggcaggttgctcccgaaccacccgttcccaaggatcaacccagc
agcacccctgaaaccaccgagctgcaggaaatccccagtatccacaaagagctgcccgaa
ggggatggatcagaaaaaagcataattcttcctgaggagcgcaaagctgaagagactgtg
atggatttcagtcagtcagcatttaaagatgatgcagggagtctgcagggctgctccagc
catcaggtgacattagaagcaaatgtgggcgccggcgtcagcattgtcatcaccgtcacc
gaagctgaggactctgacaacaccgactccgaccaggcctatgaaccgtccccagttttg
caccgaaataagcaaaaagggaataaaaaatcaagcaggagctttgattttggtaaaaaa
gagggccctgaggctggtggcgacccccaggcagaggagaaaggtctgggtgaccagggg
cacagaactggggagcagtatgaattgctcctcatagaaaccgcgtcttccctggtgaag
gcggccattcagtcgtccatagagcagctggtcaacgaaatggccctggaacagaataaa
cacaacagttttctgtga

DBGET integrated database retrieval system