KEGG   Falco cherrug (Saker falcon): 106631590Help
Entry
106631590         CDS       T02911                                 

Gene name
ENOSF1
Definition
(RefSeq) LOW QUALITY PROTEIN: mitochondrial enolase superfamily member 1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
fch00051  Fructose and mannose metabolism
fch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    106631590 (ENOSF1)
Enzymes [BR:fch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     106631590 (ENOSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C
Motif
Other DBs
NCBI-GeneID: 106631590
NCBI-ProteinID: XP_027671020
Position
Unknown
AA seq 302 aa AA seqDB search
MGEIGNNFGGFDRELTSSRILQTVSCDLSIHVDQDAKQLLFCVNFRYITDVLTDEESYKI
LQNGLFGKKERELLVAGFEGYSGTALRQGWTMFKVKVGVDLQDVICRCRFIQEMIGPDKI
MVNITFLDANQXWGIKGAIDXVTKSAEFKPLWIKKPAFPDEDMCVQMGHATISVVLALLG
IGVTTREHCHNRVVFKQLLQAKALSYLQIDSCRLGSVNENLSVLLMARKFQGKALQNAAA
MSKSFSPQPPRIHQRALDFGTVCLCELVQHLLIXDYMPVCESLESRLVIQKTPVAIDCGD
RS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaattggcaacaactttggaggcttcgacagagagctcaccagcagcagaatc
ctacaaacagtcagttgtgatctctccatacatgtagaccaggatgccaaacaattgcta
ttctgcgtgaatttcagatatatcactgatgtgctaacagatgaagaatcttataaaata
ctccaaaatggcctgtttgggaaaaaggaaagggagcttctggttgctggctttgaggga
tactctggaactgccttgagacaaggctggacaatgttcaaagtaaaggtgggtgtagat
ctgcaggatgttatttgcagatgcagatttatacaagaaatgattggcccagacaaaata
atggtgaatatcacttttttggatgcaaaccaatgatggggaataaagggagcaatagat
taggtcactaaatcagctgagttcaaacccttgtggattaagaagccagcttttccagat
gaggatatgtgtgttcagatgggacatgcaaccatttcagtggtcttagcactgttagga
attggtgtgacaaccagagaacactgccacaacagagtggtatttaaacagcttctacaa
gctaaggccttgagttatctccaaatcgacagctgcaggttgggaagtgtgaatgaaaac
ttgtctgtgctgctgatggccagaaagttccagggtaaggctctgcaaaatgcagcagca
atgagtaaatctttctctccccaacctccaagaatacaccaaagggctttggattttgga
actgtgtgtctctgtgaattagtccagcacttgctaatatgagattatatgccagtatgt
gaaagccttgaaagcagattagttatacaaaaaaccccagtagcaattgactgtggtgat
cgttcttaa

DBGET integrated database retrieval system