KEGG   Flavobacterium commune: BIW12_05515Help
Entry
BIW12_05515       CDS       T05006                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
fcm  Flavobacterium commune
Pathway
fcm00780  Biotin metabolism
fcm01100  Metabolic pathways
Module
fcm_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:fcm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BIW12_05515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fcm01007]
    BIW12_05515
Enzymes [BR:fcm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     BIW12_05515
Amino acid related enzymes [BR:fcm01007]
 Aminotransferase (transaminase)
  Class II
   BIW12_05515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_3 PRE_C2HC
Motif
Other DBs
NCBI-ProteinID: AOZ98933
UniProt: A0A1D9P8N7
Position
1328531..1329682
Genome map
AA seq 383 aa AA seqDB search
MRNLPNILKAKIESRIQNNALRQLPSEANLIDFASNDYLGFSKSELIFNQTHQYLLDNAF
VQNGATGSRLLSGNHNLYSITENFISTFHQAETALIFNSGYDTNVGFFSSVPQKGDLILY
DELCHASIRDGIQLSYSKSYKFNHNDFEDLERLILRNQNTTIYIVTESVFSMDGDTPNLK
ELVHLSEKHNCYLVLDEAHALGVFGDKGQGLVQEFDVQDKVFARIMTFGKGLGCHGAAIL
GSQELKQYLVNFARSFIYTTGLSPHSVATILVAYQFLEKENKDIKLLRENIIHFNQQKNL
LGLKPIFVRSKSAIQSVIIPGNEKVKSIAKQLQEKGFDVKAILSPTVPEGQERLRFCLHA
FNSKDEISNVLQLLSTFVFGPQI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatctacctaatatccttaaagcaaaaatagaatccagaattcaaaataatgca
ctacgccagttgccttctgaagctaatttaattgattttgcatccaatgattatcttggt
ttttcaaaatcagagttgatttttaatcaaacgcatcaatatttattagataatgctttt
gttcaaaatggagcaaccggttcccgattgctttctggaaatcataatttatatagtata
acagaaaattttattagcacatttcatcaagctgaaactgcactaatttttaattctggt
tatgataccaatgtgggattctttagttctgttcctcaaaaaggagatttgattttgtat
gatgaactatgtcatgcctccattcgtgacggaatccagttgtcttattcgaaatcttat
aagttcaatcataatgattttgaagatttagagcgattaattcttcgaaatcaaaatacg
actatctacattgttaccgaaagcgttttttcaatggatggagatacgccaaacttgaaa
gaattagttcatttgtctgaaaaacacaattgttatttagttcttgacgaagcgcatgct
ttgggtgtgtttggtgataaaggtcaaggtttggttcaggaatttgatgtgcaagacaaa
gtttttgcgcgaatcatgacttttggaaaaggcttgggttgtcatggagcagctattttg
ggaagtcaggaattgaaacaatatttggtaaactttgcccgaagttttatctatactacg
gggctttcgccacattccgttgcgacaattctggttgcttatcagtttttagaaaaagaa
aacaaggatattaagttgctgcgtgagaatatcattcatttcaatcagcaaaagaattta
ttggggttaaaacccatttttgttcgaagtaaatcggcgattcagtcggttattattccg
ggaaatgaaaaggttaaatctattgcaaaacaacttcaggaaaaaggttttgatgttaaa
gccatactttcgcctacggttcccgaaggacaggaaagactacgcttttgtctacatgct
tttaattcgaaagatgaaatttcgaatgttctacaattgttgagtacttttgtttttggc
ccacagatttaa

DBGET integrated database retrieval system