KEGG   Flavobacterium commune: BIW12_09475Help
Entry
BIW12_09475       CDS       T05006                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
fcm  Flavobacterium commune
Brite
KEGG Orthology (KO) [BR:fcm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BIW12_09475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AOZ99652
UniProt: A0A1D9PAU7
Position
complement(2230243..2230629)
Genome map
AA seq 128 aa AA seqDB search
MVSQITRGIKITVLTSFEGTYFKNYKIHFAFSYHITIENHSKDSVQLTSRHWEIFDSLNN
IEIVDGEGIIGKKPVLKPGENHTYSSGCLLSSPYGAMKGHFNMINFTNTKNFKVIIPTFR
LCAPFALN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggtttctcagataacaagaggcataaaaattaccgttttgactagttttgaaggcact
tacttcaagaactacaaaattcactttgcctttagttaccatatcaccatcgaaaaccac
agtaaagattcagtgcaacttacttctcgtcactgggaaatttttgattctctaaacaat
atagaaattgttgatggcgaaggtatcattggcaaaaaaccggttttaaaaccaggagaa
aatcacacttacagctctggttgcctcctttcttctccttacggagccatgaaaggccat
ttcaatatgattaactttaccaataccaaaaattttaaagtaatcattcctactttcagg
ctttgtgctccttttgctttaaattaa

DBGET integrated database retrieval system