KEGG   Flavobacterium commune: BIW12_12605Help
Entry
BIW12_12605       CDS       T05006                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fcm  Flavobacterium commune
Pathway
fcm00260  Glycine, serine and threonine metabolism
fcm01100  Metabolic pathways
fcm01110  Biosynthesis of secondary metabolites
fcm01120  Microbial metabolism in diverse environments
fcm01130  Biosynthesis of antibiotics
fcm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fcm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BIW12_12605
Enzymes [BR:fcm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BIW12_12605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Pyridoxal_deC Aminotran_3
Motif
Other DBs
NCBI-ProteinID: APA00199
UniProt: A0A1D9PC87
Position
3015921..3016940
Genome map
AA seq 339 aa AA seqDB search
MQINLVSDTVTKPSYEMLQYMFNADVGDDVYKQDPTVVELEERVAAIFGMEAGLFFPSGT
MANQTAIKLHTQPGEQLIADKHSHIFHFEAGGVSFNSGVSCCLVEGNRGMITADQVAAAI
NKPDFYHSPLTSLVCLENTTNIGGGACYEMEDLQKIKAVCEENNLKLHLDGARIWNALVA
KRQNPKDFGKLFDTISVCFSKGLGAPVGSVLLGDKKTIQRALRIRKVLGGAMRQSGYLAA
GAIYALENNIKLLTEDHRRAKELANILKKKTWVASVEPVETNILIFSLVPEYKDDDLIEK
LKQKNISISAVGNRKLRMVTHLDYREVMHTYVIETLAKM
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaatttagttagtgatacggttacgaaaccgtcctacgaaatgttacaatat
atgtttaacgccgatgtaggggatgatgtctataaacaagaccctacggttgttgagtta
gaagagagagtggcggctatttttgggatggaagcgggcttgttttttccttcggggact
atggcaaatcaaacggccataaaactgcatacccaaccgggtgaacaattaatagccgat
aaacattcgcatatatttcattttgaagctggtggcgtttcttttaacagtggggtttcc
tgctgcttagttgaaggaaatcgcggaatgattaccgctgatcaggtggccgctgcaatc
aataagcctgatttttaccacagtccgttaacgagtttggtttgtcttgaaaacacaacc
aatattggtggtggtgcctgttatgaaatggaggatttgcaaaaaataaaagccgtttgt
gaggagaataatttgaaattacacctggatggtgcccgaatctggaatgctttggtggcc
aaaagacagaatccgaaagattttgggaaactatttgatactatttcggtttgtttctca
aaaggattgggagcgcctgtaggttcggttttgttaggcgataaaaaaacaattcagcgt
gctttgagaatccgaaaagtattgggaggtgctatgcgtcaatcgggatatttggcggca
ggtgcaatttatgctttggaaaataatatcaaattgttaaccgaagatcaccgaagagct
aaggaattggcaaatattttgaagaaaaaaacttgggtagcctcggtggagcctgtagaa
accaatattttaattttttctttagttccggaatataaagacgatgatttgattgagaaa
ttaaaacaaaaaaacatctcgattagtgccgttggaaatagaaaattaagaatggtgacg
catttggattatcgcgaggtaatgcacacctatgtaattgaaaccttggcgaaaatgtag

DBGET integrated database retrieval system