KEGG   Francisella hispaniensis 3523: FN3523_1166Help
Entry
FN3523_1166       CDS       T02078                                 

Definition
(GenBank) Proline dehydrogenase (Proline oxidase) / Delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
fcn  Francisella hispaniensis 3523
Pathway
fcn00250  Alanine, aspartate and glutamate metabolism
fcn00330  Arginine and proline metabolism
fcn01100  Metabolic pathways
fcn01110  Biosynthesis of secondary metabolites
fcn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fcn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FN3523_1166
   00330 Arginine and proline metabolism
    FN3523_1166
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fcn03000]
    FN3523_1166
Enzymes [BR:fcn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     FN3523_1166
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     FN3523_1166
Transcription factors [BR:fcn03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    FN3523_1166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH GAIN
Motif
Other DBs
NCBI-ProteinID: AEE26469
UniProt: F4BG75
Position
complement(1180108..1184172)
Genome map
AA seq 1354 aa AA seqDB search
MNDLLNHSGEYPISKEIMNISKYWLIDEKEAMTKLVEKAHMSSVQKAQVRERAYGLVEKV
RKNRLKKSGIDAFMIEYDLSSEEGIVLMCLAEALLRVPDKYTIDLLIKDKLTSAAWKSHV
GREKHLFVNAATWSLMLTGKILKNPHGSYRKVFQNLLKKSSEPVIRQAMKQAMKIVGKQY
VLGETIEEALKVSEAKVARGYSYSYDMLGEAAMTMDDAEYYYGQYLHAIHELAKYATNTE
IKKNPGISIKLSALHPRYEVAKHQRVHTELYPKLLKLTQLAKDYNVGMNIDAEETERLQI
SLELVERLAHEPSLEGFNGIGIVVQAYQKRAPYVLDYLANLAKKTNRRFMIRLVKGAYWD
AEIKHAQEQGLAGYPVFTRKYHTDVSYQACVKQLFENHQYIYPQFATHNAQTVAVVFELA
NGNRDFEFQCLHGMGDALYDNVIGKEGYEDIPCRVYAPVGGHKHLLAYLVRRLLENGANS
SFVNRIVDENLPIEELIEDPVKKAIDHGCGQHPNIPYPKDIVAPRLNSQGHNTNDFVVLT
DMYKQIEKYTLKNTYKAKPIVSGIDLDKTIAESVINPNTNEVIGSVINADVKIAKRALKN
AQSAFEEWSNTPATKRADILEKFADLLEQNTNKFIAIAMIEAGKTLANAIDEVREAVDFC
RYYAAQARKEFNGPIDLPALSDHLKQIEFTGRGAMVCISPWNFPLAIFLGQITAVLAAGN
TVVAKPAEQTPIIAYKAIKLLFKAGLPKNVLQFTPGDGATVGSALVKSPVCKGVIFTGST
EVAAIINQTLANKSSEIVPFIAETGGQNAMIVDSSSLPEQVTADVIRSAFDSAGQRCSAL
RILCLQEDIADNYIKMIVGAMKELKIGNSKYIDTDVGPVIDKEAADNLNAYIEEKKSQFK
LIYQAQPNQDTQKGTFVMPTAFEIDKISDLGREQFGPILHILRFKANQLDKLINDINATG
YGLTAGVHSRINEVMNYVKNNLKAGNIYVNRNIVGAVVGVQPFGGQGKSGTGPKAGGPYY
MHRLANEKLSGVGAVEEIYNPEKIAEDEKQTNKLIKDKYTITNIVAGERTKKDKYTSLKA
ANGKTIGSKYIASVNTVDNAIEIASKEAELWNHVNAEKRAATIEKFLELLEKERHLIASC
LVVESNISVEDAHIQIDKTIQQVAYYCLQAKKEFAHPQLLPGPTGEIDELSLKGRGVVVS
MCSSSDLLIRFVGQTAAALLAGNTVVAKPAYTGNLTAYNIVKLMLKAGINPKVLHLVLSD
DEEITSALLFNSKVALVAFSGSVSAVKQVHQALALRRGAIIPFVAESVAKDDKCTSLAIE
TASPLYLRRFVVEKTVSVDTTASGGNASLMSLEE
NT seq 4065 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacttactaaatcactcaggagaatatcctatttctaaagaaataatgaatata
tctaaatattggcttattgatgaaaaagaagcaatgacaaagcttgttgaaaaagctcat
atgtcaagtgttcaaaaagcgcaagttagagaaagagcttatggcttggtagaaaaagtc
agaaaaaatagactcaaaaaatctggtattgatgcgtttatgatcgagtatgatttatcc
tcagaagagggaatagtgctaatgtgtttagctgaagcacttttaagagtacctgataaa
tatactattgatttacttatcaaagataaacttacaagtgctgcgtggaaaagccacgtt
ggtagagagaagcatttatttgttaatgctgcaacatggagtttgatgctaactggtaaa
attttaaagaatccgcatggatcatatagaaaagttttccagaacttactaaaaaaatca
agtgagccagtaattcgtcaagctatgaaacaagcgatgaaaattgttggtaagcaatat
gtacttggtgaaactattgaagaagctctaaaggtatcagaagctaaagtagctagaggc
tatagttactcttatgatatgcttggtgaagctgcaatgacaatggatgatgctgaatac
tattatggtcaataccttcatgcgatacatgagttggctaagtatgctacaaatacagag
atcaaaaaaaatcctggaatttctataaaattatctgctttacatccacgttacgaggtt
gcaaagcaccaaagagttcatacagaattatatccaaaactgcttaagcttacgcaatta
gcaaaagactataatgttggtatgaatattgatgccgaggaaacagaaagattacagata
tcattagagctagtagaaagactagctcatgaaccatctttagaagggtttaatggaatt
ggtattgttgttcaagcatatcaaaaaagagctccttatgtattagactatttagctaac
cttgctaagaaaacaaatagaagatttatgattcgcttagttaagggggcatattgggat
gctgaaattaagcatgcgcaagagcaaggtttagcaggttatccagtatttacgcgtaag
tatcatacagatgtttcatatcaggcttgtgttaaacagctttttgagaatcatcaatat
atctatcctcagtttgcaacacataatgctcaaactgtcgctgtagtatttgagttagct
aatggtaatagagattttgaatttcaatgtctgcatggtatgggtgatgcactatatgac
aatgttattggtaaagaaggttatgaagatattccatgcagggtatatgctccagttggt
ggtcataagcatcttttagcatatctagttagacgattactagagaatggtgctaatagc
tcttttgtaaatagaattgtcgatgaaaatttacctattgaagaactaatagaagaccca
gttaaaaaagctattgatcatggttgtggtcagcatcctaatattccttatccaaaagat
atagttgcaccaagattgaattcacaaggtcataacaccaatgattttgttgttttgact
gatatgtataagcaaatagaaaaatatacgcttaaaaatacatataaagcaaaacctata
gtttccggtattgatcttgataaaacaatagctgaaagtgttataaatccaaacactaat
gaagttatcggtagtgtaattaatgctgatgttaagatcgctaaaagagcattaaaaaat
gctcaaagtgcatttgaagagtggagtaatacaccagcaacaaaaagagctgatattcta
gagaaatttgctgatcttttagaacaaaatactaataaattcattgctatagcgatgatt
gaagctggtaagaccttggctaatgctatagatgaggtcagagaggctgtagatttttgt
cgttattatgctgctcaagctagaaaagaatttaatggtcctattgatttgccggcacta
tctgaccatcttaaacagatagagtttaccggtcgaggagctatggtatgtattagtcct
tggaatttcccattagcaatatttctaggacagattacagctgtgttagcagctggtaat
acagtagttgctaaaccagctgagcagacaccaataattgcttacaaagcaatcaaactt
ctatttaaagctggtttgcctaaaaatgttttacaatttacacctggagatggtgcaaca
gttggtagtgcactagttaaaagtccagtatgcaagggtgtgattttcacaggctctaca
gaagttgcggctattataaatcaaactttagcaaataaatctagtgaaatagtaccattt
attgctgagacaggtggacaaaacgctatgattgttgactcatcatcacttcccgagcag
gttacagcagatgtgatacgctcagcctttgatagtgcggggcaacgctgttcagcatta
cgtatcttatgtcttcaagaagatatcgctgataactatattaagatgatagttggtgca
atgaaagaacttaaaataggcaattcaaaatatattgatactgatgttggtcctgtgatc
gataaagaagctgctgataacctaaatgcgtatattgaagagaaaaaaagccagttcaag
cttatatatcaagctcagcctaaccaagatactcaaaagggcacatttgtgatgcctact
gcttttgagatagataaaatatctgatttaggcagagagcagtttggtccaattttacat
atcttgcgctttaaggctaatcaactagataagcttatcaacgacatcaatgctacagga
tatggtttgactgcaggtgttcacagtagaattaatgaggtgatgaactatgtcaaaaat
aaccttaaagctggtaatatctatgtaaatagaaatattgttggtgctgttgttggtgtc
cagccatttggtggtcaaggtaagtcaggaactggtcctaaggctggtggaccttattat
atgcatcgtttagctaatgaaaaattatcaggagtaggtgccgttgaagagatttataat
cctgaaaaaatagctgaagatgaaaagcagactaataagcttatcaaagataaatatacc
attacaaatattgttgctggtgagagaactaaaaaagataaatatactagtcttaaagca
gctaatggtaaaactattggtagtaaatacatagcttctgtgaatactgtagataatgct
atagaaattgcgagtaaagaagcagagctatggaatcatgttaatgctgaaaaaagggct
gctactattgagaagttcctagaactattagagaaagaacgtcatttgatagcttcatgc
cttgtagtagagtcaaatatttcagttgaagatgcccatatccaaatagataaaactatt
cagcaggtagcatattattgcctacaagctaaaaaagagtttgctcatccacaactttta
cctggacctacaggcgagattgatgagttaagcttaaaagggcgcggtgttgtggtaagc
atgtgctcaagttctgatttactcattagatttgttggtcaaacagcagcagctttatta
gcgggtaatactgtagtagctaagccagcatatactggtaacttaactgcttataatatt
gttaaattaatgttaaaagcaggaataaaccctaaagtacttcatctagtcttgtcagat
gatgaagagataacatcagcattactattcaatagtaaagttgcactagttgctttctct
ggtagtgtttctgcggttaaacaggttcatcaggctttagcattacgtagaggagcaatt
ataccttttgttgccgaaagtgtagctaaagatgataaatgtacaagcttagctatagaa
acagcttcaccattatatttacgcaggtttgtcgttgaaaaaactgtaagtgttgataca
actgcatctggtggtaatgcttctttaatgagcctagaagaataa

DBGET integrated database retrieval system