KEGG   Francisella hispaniensis 3523: FN3523_1184Help
Entry
FN3523_1184       CDS       T02078                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
fcn  Francisella hispaniensis 3523
Pathway
fcn00520  Amino sugar and nucleotide sugar metabolism
fcn01100  Metabolic pathways
fcn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FN3523_1184
Enzymes [BR:fcn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     FN3523_1184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AEE26487
UniProt: F4BG93
Position
complement(1199505..1200638)
Genome map
AA seq 377 aa AA seqDB search
MQSYILKGGKIYAQNDFEAKDIVVKDNIISAILDDAKAATFNLPIIELSSDDYVIPGFID
IHIHGSKGADVMDGDVDALAVISKSLYTQGVTSYLATTMTAANEQILKAMLAIKDYNSQT
HLDSAKIVGVHLEGPFISPGKIGAQNPNYLQEADVTKMTNWHNACDALIKKITIAPEIKN
ANKVIEFCNSKNIISSIGHTSCTMAQALEAIEQGCSHATHLFNAMSPIEHRNPGAATALL
MSKKVLAELIVDGIHLHPDMVKFTYTIKGSDNIALITDAMSAQSAGEGVFELGGQKVIVK
DGQARLENGVLAGSVLTMNKALENVLKFTNCSLYDAVKMTSTNQAKSLGLKKGQIKVGFD
AEFVILDKNYQVKQVIG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagctatattctaaaaggtggcaaaatttatgcccaaaatgattttgaagctaag
gatattgttgtcaaagataatattatcagtgctatacttgatgatgcaaaggcagctact
tttaatttacctatcattgagctaagttctgatgattatgtgatacctgggtttatcgat
atccatatccatggttcaaaaggtgctgatgtaatggatggtgatgttgatgctttagct
gtaatctctaaatcactatatacacaaggagttactagctatctggcaactacaatgaca
gcagcaaatgagcaaatactcaaagcaatgctcgcgatcaaagattataattctcaaact
cacttggatagtgcaaaaattgttggtgttcatcttgaggggccatttatatcaccaggt
aagattggcgcacaaaatcctaattacctccaagaagcggatgttactaaaatgacaaat
tggcataatgcttgtgatgctttaatcaaaaaaatcactattgccccagagattaagaat
gctaataaagtaatcgaattttgtaactctaaaaatataattagctcaataggtcacact
agttgtactatggctcaagctctagaggcgatagagcagggttgttcacatgcaacacat
ttatttaatgcaatgagtcctatcgagcatcgtaatcctggtgcagcaacagccttatta
atgtcaaaaaaagttttagcagaattgatagtcgatggtatacatttacatcctgatatg
gtcaagtttacctatactataaagggtagtgataatattgctttaatcactgatgcgatg
tctgctcaaagtgctggagaaggtgtctttgaattaggtggtcagaaagtaatagtcaaa
gatggtcaagcaagattagagaatggtgtactagcaggaagcgtcttgacgatgaataaa
gctctagagaatgtcttgaaatttacaaattgtagtctctatgatgctgtgaaaatgaca
agtacgaatcaggctaagtcattagggcttaaaaaaggtcaaatcaaagtaggctttgat
gctgagtttgtaattctcgataaaaattatcaagttaaacaagttattggttag

DBGET integrated database retrieval system