KEGG   Francisella hispaniensis 3523: FN3523_1381
Entry
FN3523_1381       CDS       T02078                                 

Definition
(GenBank) hypothetical protein
Organism
fcn  Francisella hispaniensis 3523
SSDB
Other DBs
NCBI-ProteinID: AEE26684
UniProt: F4BGU0
Position
1416469..1417629
AA seq 386 aa
MSELISTLNSIELVTQDKINLIANMQIHAKYENAEYKSFIDQLIDNINVNKSIDIYSLFL
SLNSEICLNLCEIDNIAEIISSYLSILNTNFTKISPSESKQKDELAEKGINKFLVTMDIN
FAEMKNQNNLSLNNIELLIKLIEQITIFFENNNLNYNPDLKIQLNKTLKKIKDSLILEDQ
KSHESKVKETINETKKKEQASITDKKTIQGSEKWITLIEKIEVLKALVESERIFETSIVY
NDIQNLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSSIQWSIAQKMYNIDYKS
FLDNLEKMPENNFLNSSPDITKNFFYETSSELKKTPIQDHKIMAEADAIKKEIEIKQHPN
VKKNQNNGEKISSEIDEEYFEDLFDI
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgagtgagctaatatctacattaaacagtattgagttagtaactcaagataagataaat
cttattgctaacatgcaaatccacgcaaaatatgaaaatgctgagtataaatcatttatt
gatcaattaatagataatattaacgttaataaaagcatagatatatatagtttatttcta
tctttaaattcagaaatatgccttaatttatgtgagattgataacatcgctgaaattatt
agctcttatttatctattctaaataccaatttcacaaaaattagtccatcagaatcaaaa
caaaaagacgagttggctgaaaaagggataaataaattcttagttactatggatataaat
tttgcagaaatgaaaaatcaaaataacttatcattaaataacatagaattacttataaaa
cttatagagcaaataacaatattttttgagaataataatttaaattataatcctgattta
aaaatccagctaaacaagactcttaaaaaaataaaggattctttgattttagaagatcaa
aaaagtcatgagtctaaagttaaagaaacaataaatgaaacaaaaaagaaagaacaagcg
agtattacagataaaaaaaccatacaaggttctgaaaaatggataaccctcattgaaaag
attgaagttttaaaagctttagttgaaagtgaaaggatatttgaaacttctattgtttat
aatgatatccaaaatttattagttaacttcgatcctaaagagtattttcctgaaattttc
ttcccattatacaagaaaatagctccttttattggcaatatccataaaaacatagactac
tactcatcaagtatccaatggagcatagctcaaaaaatgtacaacatagattacaagagt
tttttagataatcttgaaaaaatgccagaaaataattttttaaattcttctcctgatata
actaaaaatttcttttatgaaacatcttctgaactaaaaaaaacccctatacaagatcat
aaaataatggctgaagcagatgccatcaaaaaagaaatagaaataaaacagcatcctaat
gttaaaaaaaatcaaaataatggagaaaaaatttcaagtgagatagatgaagaatatttt
gaagatctttttgacatataa

DBGET integrated database retrieval system