KEGG   Flavobacterium columnare: FCOL_00870Help
Entry
FCOL_00870        CDS       T01653                                 

Definition
(GenBank) 2-dehydro-3-deoxyphosphooctonate aldolase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
fco  Flavobacterium columnare
Pathway
fco00540  Lipopolysaccharide biosynthesis
fco01100  Metabolic pathways
Module
fco_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:fco00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    FCOL_00870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:fco01005]
    FCOL_00870
Enzymes [BR:fco01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     FCOL_00870
Lipopolysaccharide biosynthesis proteins [BR:fco01005]
 Unusual sugar
  FCOL_00870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DUF5091 NeuB Adaptin_binding
Motif
Other DBs
NCBI-ProteinID: AEW85023
UniProt: G8X886
Position
complement(209490..210308)
Genome map
AA seq 272 aa AA seqDB search
MNLENIPNIKHLDSNNFFVLSGPCAIEGEEMAMKIAERLVKITDDLKIPYVFKGSFKKAN
RSRVDSFTGIGDEKALKILQKVSKEFNVPTITDIHTNEDAAMAAEFVDILQIPAFLVRQT
DLVVAAAQTQKTVNLKKGQFMSPESMKHAVQKVLDSNNENVMVTDRGTMFGYQDMIVDFR
GIPTMRQMATTVLDITHSLQQPNQLVGVTGGRPDMIETIAKAGIAVGVDGIFIETHFDPA
HAKSDGANMLHLDYFENLMKKLVAIRQTVNQF
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaatctagaaaatattcctaatatcaaacatttagatagcaacaatttttttgttctt
tctggaccttgtgccatagaaggtgaagaaatggccatgaaaatagccgaacgtttagta
aaaattacagatgatctaaaaattccttatgtatttaaaggttcatttaaaaaagccaat
cgctctcgcgtagacagttttacaggtattggagatgaaaaagcccttaaaattttacaa
aaagtaagtaaggagttcaatgttcctaccattactgatattcatacgaacgaagatgct
gcaatggcagccgaatttgttgatatcttacaaatacctgctttcttagttcgccaaaca
gatttagttgtagctgctgcacaaacccaaaaaacagttaatttaaaaaaaggacaattc
atgagtcctgaaagcatgaaacatgctgttcaaaaagtattagactctaataatgaaaac
gtaatggttacagatagaggaactatgtttggatatcaagacatgattgttgatttcaga
gggattcctactatgcgtcaaatggctactaccgtattagatataactcattccttacaa
caacctaatcaattagtaggcgtaacaggtggtagacctgatatgattgaaaccattgca
aaggcaggaatagctgtaggtgttgatggtatatttatagaaacacattttgatcctgct
catgctaaaagtgatggagctaatatgttacatttggattattttgaaaatctaatgaaa
aaattagttgcaattagacaaacagttaatcaattttaa

DBGET integrated database retrieval system