KEGG   Flavobacterium columnare: FCOL_06665Help
Entry
FCOL_06665        CDS       T01653                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fco  Flavobacterium columnare
Pathway
fco00010  Glycolysis / Gluconeogenesis
fco00030  Pentose phosphate pathway
fco00051  Fructose and mannose metabolism
fco00052  Galactose metabolism
fco00680  Methane metabolism
fco01100  Metabolic pathways
fco01110  Biosynthesis of secondary metabolites
fco01120  Microbial metabolism in diverse environments
fco01130  Biosynthesis of antibiotics
fco01200  Carbon metabolism
fco01230  Biosynthesis of amino acids
fco03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FCOL_06665
   00030 Pentose phosphate pathway
    FCOL_06665
   00051 Fructose and mannose metabolism
    FCOL_06665
   00052 Galactose metabolism
    FCOL_06665
  Energy metabolism
   00680 Methane metabolism
    FCOL_06665
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    FCOL_06665
Enzymes [BR:fco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FCOL_06665
Protein phosphatases and associated proteins [BR:fco01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FCOL_06665
Messenger RNA biogenesis [BR:fco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FCOL_06665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEW86154
UniProt: G8X4V6
Position
complement(1550246..1551235)
Genome map
AA seq 329 aa AA seqDB search
MSNKSIKKIGVLTSGGDSPGMNAAIRSVVRTCAFYNIECIGIYRGYQGMIEGDFKEMGAR
SVNHIIDKGGTILKSARSKDFRTIEGRTLAFKKIKEAQIDALVVIGGDGTFTGAEIFNKE
FNFPVMGIPGTIDNDIYGTSHTLGYDTALNTVVEAIDKIRDTASSHNRLFFVEVMGRDAG
HIALNAGIGAGAEEILIPEEDLGLDRLLESLKRSKASGKSSSIVVVSEGDKIGKNVFELK
EYVEENLPEYDVRVSVLGHMQRGGSPSCFDRVLAARLGVKAVESLLEGKSNYMVGLLEDK
VALTPLEQAIKGHSKIDQELLKVSDIMST
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataaaagtataaagaaaataggagtcttaacctcaggtggagattccccagga
atgaatgcggcaattcgatctgttgtaagaacgtgtgccttttataatatagaatgtata
ggtatttatagaggttatcaaggaatgatagaaggagattttaaagaaatgggtgctcgt
tccgtaaaccatataatagataaaggggggacaatacttaaatctgctcgttccaaagat
tttagaaccatagaaggcagaacattagcctttaaaaaaataaaagaagcgcaaatagat
gccctagttgtaataggaggtgatggaacctttaccggtgcagaaatctttaataaagaa
tttaattttcccgtaatgggaattcccggtaccattgacaatgatatttatggtacaagt
catacattaggatatgataccgccctaaacaccgtagtagaagctattgataaaattaga
gatacagctagttcacataacaggcttttttttgtggaagtaatggggcgtgatgctggc
catattgccctaaatgcgggtataggagcgggcgcagaagaaattcttattcccgaggaa
gatttaggattagaccgattattagaatccttaaaaagaagtaaagcttcaggcaaatca
tcaagcatagtagtcgtatcagaaggagataaaataggtaaaaatgtgttcgaactaaaa
gaatatgtcgaagaaaatttaccagaatatgacgttcgagtgtctgtgttaggtcacatg
caaagaggaggttccccttcttgttttgatagagtattagcagctcgtctaggagtaaaa
gcagttgaatctcttttagaaggaaaatccaattatatggtaggattgttagaagataaa
gtagctttaacgcctttagaacaagctataaaaggtcattctaaaattgatcaagaattg
cttaaagtttcagacatcatgtctacttaa

DBGET integrated database retrieval system