KEGG   Flavobacterium columnare: FCOL_09750
Entry
FCOL_09750        CDS       T01653                                 

Definition
(GenBank) PKD domain-containing protein
Organism
fco  Flavobacterium columnare
SSDB
Motif
Pfam: PKD_4 PKD
Other DBs
NCBI-ProteinID: AEW86759
UniProt: G8XBH9
Position
complement(2288183..2289253)
AA seq 356 aa
MKRFFNKFNYLTKIDVRIFLGFGLLILLGFGIFLFKYSRHIDCNNGNFLITADEFKPNEV
VEFFDNTKGASSWEWDFGDSTVVDNRQRTFHKYKKEGDYVVKLIVNGSCYYEKLIRITNV
GQQTGYLPLIKAPNVAFLGEVVRFSAEKNGGESWEWSFGETTSLDAVGQNVSYKFKTTGE
KKITLIVNGDLEHIATKIIYVAPKVIVAKQKIDMETYEYEKPHSTFSLPRGMAKKDPLED
MLGYIPVSPKHDTHKESTEKTKTTEISNEQFQLLLKQVAAQVKTKDDFKEYLCGNFEIPV
VVNDDNVMSFSELCKSISGKQIKITFLQLNRNENNNCIQNINIKYKTKKWMIWVKE
NT seq 1071 nt   +upstreamnt  +downstreamnt
gtgaaacgattttttaacaaatttaattatttaaccaaaatagatgtaagaatcttttta
ggttttggacttttaatccttttaggctttggaatattcctttttaaatattctcgtcat
atagattgtaacaatggtaactttttaattacagctgacgaattcaaacctaatgaggtg
gttgagttttttgacaacaccaaaggtgcttcaagttgggagtgggattttggagatagt
acagttgtcgataaccgacaaagaacatttcataaatacaaaaaagaaggagattatgtc
gttaaactaatcgtgaacggaagttgttactatgaaaaattaatacgaataacaaacgtt
ggacaacaaacagggtatctccccttaataaaagctccaaatgtagctttcttgggagaa
gttgttcgctttagtgctgaaaaaaacggaggagaatcttgggaatggagttttggggaa
actacatcgttagatgccgtaggacaaaatgtgtcctacaaattcaaaacaactggagaa
aagaaaataaccttaatcgttaatggagacttagagcacattgccactaaaataatctat
gttgctccaaaagttattgttgctaaacagaaaatagacatggaaacctatgaatatgaa
aagccccattctaccttttctcttcctcgaggaatggctaaaaaagaccctctagaagat
atgttaggatacattcctgtatctccaaaacatgatactcataaagaatcaaccgaaaaa
acaaaaacaaccgaaatatctaacgaacaatttcaactattactaaaacaagtagcagct
caagtaaaaaccaaagacgattttaaagagtatttgtgtggcaattttgaaatccctgtt
gttgtaaatgatgataacgtaatgtctttttcagaattatgtaaatctatttctggaaaa
cagattaaaataacattcctacaattaaatagaaatgaaaataataactgcattcagaac
attaatatcaaatacaaaaccaaaaaatggatgatttgggtaaaagaatag

DBGET integrated database retrieval system