KEGG   Flavobacterium columnare: FCOL_09975Help
Entry
FCOL_09975        CDS       T01653                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
fco  Flavobacterium columnare
Pathway
fco00380  Tryptophan metabolism
fco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    FCOL_09975
Enzymes [BR:fco01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     FCOL_09975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: AEW86804
UniProt: G8X4Y8
Position
2349299..2350222
Genome map
AA seq 307 aa AA seqDB search
MNDYSNLVDKIDQKYQSLDQKTEAYLEGLLWSKPITYWDYIQTDALLSLQNQRTIFPDEN
VFIMYHQINELLFKMILWEIKQVSYAQKLTTEFFTDRLMRISRYFDMLTTSFTIMGEGME
VEQYMKFRHTLTPASGFQSAQYRMIEFCSTDLINLIDYRYRTTIDRNTSYHHAFEHLYWQ
AAGKNYETGEKSYFLKQFEERYKKEFLQIMEEYNTINLWRKFKELPVEDQQNTELINAMR
HYDYTVNITWVMGHYRAAQKYIDNGKGNGEATGGSDWKKYMHPRYQRRIFFPELWSEEEL
KNWGEQV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattattctaatctagtagataaaatagatcaaaaataccagtctctagatcaa
aaaacagaagcctacttagaagggcttctttggtctaaacctattacatactgggattat
attcagacagatgctttgttaagtcttcaaaatcagcgtactatatttccagatgaaaat
gtgtttatcatgtatcatcaaataaatgaacttttatttaaaatgattttatgggaaata
aaacaagtttcttacgctcaaaaactaacaacagaattctttacggatagacttatgcgc
atcagtcggtattttgatatgttaaccacatcatttacaataatgggagaaggaatggaa
gtagaacaatacatgaaattccgtcatacactaactccagccagtggttttcagagcgca
cagtatcgtatgatagaattttgttcgaccgatttaatcaacttaattgattatcgttat
agaacaactattgatagaaatacttcttatcatcatgcttttgaacatttgtattggcaa
gctgcgggaaagaattacgaaacaggtgaaaaatcgtattttttaaaacaatttgaagaa
agatataaaaaagaatttcttcaaattatggaagaatataataccattaatctatggcgt
aagtttaaagaattacctgttgaagatcagcaaaatacagaattaattaatgctatgcgt
cattacgattataccgtaaacattacttgggttatgggacattatcgtgctgctcaaaaa
tatatagataatgggaaagggaatggagaagcaactggcggtagtgattggaaaaaatac
atgcacccacgttatcagcgccgtatattcttccctgaattatggtctgaagaagaacta
aaaaattggggagagcaagtataa

DBGET integrated database retrieval system