KEGG   Flavobacterium columnare: FCOL_10665Help
Entry
FCOL_10665        CDS       T01653                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
fco  Flavobacterium columnare
Pathway
fco00360  Phenylalanine metabolism
fco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fco00790  Folate biosynthesis
fco01100  Metabolic pathways
fco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    FCOL_10665
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FCOL_10665
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FCOL_10665
Enzymes [BR:fco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     FCOL_10665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AEW86936
UniProt: G8X695
Position
2520754..2522511
Genome map
AA seq 585 aa AA seqDB search
MEIHFESNPLIDRLPQHLKQFIIPQNYEDYTPINQAVWRYVMRKNVDYLSKVAHDSYLKG
LQQTGIDTNNIPNMYGMNRILKEIGWAAVAVDGFIPPSAFMEFQAYNVLVIACDIRQLEH
IEYTPAPDIIHEGAGHAPIIANPEYAEYLRRFGEIGCKAISSARDYELYEAIRLLSILKE
AENTPEEEIKKAEEQVYFLQNNMGEPSEMAQIRNLHWWTVEYGLIGTIETPKIYGAGLLS
SIGESEWCMTDNVKKIPYNLSAANQSFDITKPQPQLYVTPDFAHLSLVLEEFANKMALRT
GGLSSIQKLINSKALGTIELSTGLQISGVFTNVIENENKPVYIQSTGKTALSYREKELVG
HGTQYHAEGFGSPIGKLKGINLAIEDMSPRDLCAYDIYEGKQITLEFEGDIKVTGEIITG
TRNIQGKILIIKFKNCTVTYGQQVLFQPEWGIYDMAVGKEIISAFSGPADANSFDMISHV
PSTKTIKQQKSAEREELEQLYLNVRNIREEKKANITLNQIFDILTNNHPNDWLLAIEIIE
IAHKENNDDLANKILNYLENVKIKRPETKKLIQNGLDLIFKKVFT
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggaaatccattttgaaagcaatcccttaatcgaccgattacctcaacatttaaagcaa
tttatcatcccacaaaattacgaggactacactcctattaatcaagcggtttggcgttat
gtaatgcgtaaaaatgtagattatctttcaaaagttgcacatgattcttatctaaagggg
cttcaacaaacaggtatagatacaaataacattcctaatatgtacggaatgaatcgtatt
ctaaaagaaattggatgggctgcagtagctgtagacggtttcatacctcctagtgccttt
atggaatttcaagcatataatgtattagtaattgcttgcgatattcgccaattagaacat
atagaatacaccccagcccctgatattattcacgaaggagcaggtcatgcccctatcatt
gcaaatccagaatatgcggaatatttaagacgctttggagaaattggttgtaaagccatc
tcttctgcaagagattacgaactatacgaagccattcgtttgctttctattctgaaagaa
gccgaaaacacgcctgaagaagaaataaaaaaagcagaagaacaagtttacttccttcaa
aacaatatgggagaaccttctgaaatggctcaaataagaaacttacattggtggactgtt
gaatatggcttaataggaactatcgaaacccctaaaatatacggagcaggattactttcc
tcaataggagaaagcgaatggtgcatgactgataatgtaaaaaaaatcccttataaccta
agtgctgccaatcagagttttgacattacaaaacctcaaccacagttgtatgtaacccct
gattttgcccatttaagtttagttttagaagagtttgcaaacaaaatggcattacgaaca
ggaggcttatcaagcatacaaaaactgataaactcaaaagctttaggaactattgaatta
agcactggtttgcaaatttcgggtgtatttaccaacgtaatagaaaatgaaaacaaacct
gtttacattcaatcaacaggaaaaacagccttatcttatcgcgaaaaggaattagtaggt
cacggaacccaataccacgctgaaggttttggctcacctataggaaaactaaaaggaatt
aaccttgctattgaagacatgagtcctcgcgacttatgtgcttatgatatttatgaagga
aaacaaattacactagagtttgaaggagatattaaagttacaggtgaaatcattacaggc
acacgcaatatacaaggaaaaatattaattattaaattcaaaaactgtactgttacatac
gggcagcaagtattattccagcctgaatggggaatttatgatatggctgtaggaaaagaa
attatttctgcattttctggaccagcagatgcaaatagttttgatatgattagccatgta
ccttcaactaaaactatcaaacaacaaaaatcagctgaacgagaggaattagaacaatta
tatttaaatgttcgaaatattcgagaagagaaaaaagctaacataacgctaaaccaaatt
tttgatatattaacaaataaccacccaaacgattggttactagctatagaaattatagaa
atagcacataaggaaaacaatgatgatttagcaaacaaaatactgaattatctagaaaat
gttaaaattaaaagaccagaaacaaaaaaacttatacaaaacggtttggacttgattttt
aaaaaagttttcacataa

DBGET integrated database retrieval system