KEGG   Flavobacterium columnare: FCOL_12915Help
Entry
FCOL_12915        CDS       T01653                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
fco  Flavobacterium columnare
Pathway
fco00230  Purine metabolism
fco01100  Metabolic pathways
Module
fco_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FCOL_12915 (gmk)
Enzymes [BR:fco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FCOL_12915 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 ABC_tran CPT AAA_22 RsgA_GTPase Herpes_BLRF2 AAA_23 cobW AAA_19 DUF1965
Motif
Other DBs
NCBI-ProteinID: AEW87378
UniProt: G8XAS2
Position
3022580..3023155
Genome map
AA seq 191 aa AA seqDB search
MNKEGKLIVFSAPSGSGKTTIVRHLLGIDELNLEFSISAATREPRGQEVNGKDYYFMSIE
DFKKHIKAEDFVEWEEVYRDNFYGTLKKEVERIWAMGKNVIFDIDVAGGLRIKKKFPEQT
LAVFVKPPSVDELKRRLKERSTESEDKINMRIAKAHVELATAPQFDTVIKNYDLDVAKQE
AYELVKGFVSK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagaaggaaaattaatcgtattctcagcaccatcaggttctggaaaaaccact
atagtaagacacttattaggtattgacgaattgaatttagaattttcaatctcggctgca
actcgtgaacctagaggacaggaagtaaatggaaaagactattacttcatgtcgatcgaa
gattttaaaaaacatattaaagcagaagactttgtcgagtgggaagaagtataccgagat
aatttttatggtacgctgaaaaaagaagtagaacgcatttgggcgatgggcaaaaatgtg
atttttgatattgatgttgccggtggtttgcgtatcaaaaagaaattcccagaacaaact
ctagccgttttcgtaaagccacctagtgtggacgaattgaaacgtcgtttaaaagaacgt
tcgacagaaagcgaagataaaatcaatatgcgtattgctaaagctcacgtagaattagct
accgctcctcagtttgacaccgttatcaagaattatgatttagatgtggccaaacaagag
gcttatgaattggtgaaggggtttgtatccaaatag

DBGET integrated database retrieval system