KEGG   Fragilariopsis cylindrus: FRACYDRAFT_140013Help
Entry
FRACYDRAFT_140013 CDS       T04784                                 

Definition
(GenBank) Clavaminate synthase-like protein
  KO
K16914  bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 [EC:1.14.11.- 1.14.11.27]
Organism
fcy  Fragilariopsis cylindrus
Brite
KEGG Orthology (KO) [BR:fcy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:fcy03009]
    FRACYDRAFT_140013
   03036 Chromosome and associated proteins [BR:fcy03036]
    FRACYDRAFT_140013
Enzymes [BR:fcy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone-H3]-lysine-36 demethylase
     FRACYDRAFT_140013
    1.14.11.-  
     FRACYDRAFT_140013
Ribosome biogenesis [BR:fcy03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    FRACYDRAFT_140013
Chromosome and associated proteins [BR:fcy03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    FRACYDRAFT_140013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_4 Cupin_8 HrpB1_HrpK HTH_22
Motif
Other DBs
NCBI-ProteinID: OEU16720
JGI: 140013
UniProt: A0A1E7FEY5
Position
Unknown
AA seq 359 aa AA seqDB search
LWSNYDKGCTIRLLRPHKHCDAIQSLLSTLEVEFQCMIGANAYLTPPRSSQGFAPHYDDI
DAFCLQLQGSKRWKVYKPTIKLPRTSSEDFTTEDLEDMEPVLDITLNEGDLLYMPRGYIH
QACTLNDNSHHSIHLTISAMQQWAWVDLMEIVVPDALNAAAMSESSTSLRKGLPQGFMEY
MGVMYEEPNDEKLPDTLKIAGQEEKTAKKRIMEVAETACTMLDAACDEMATRYMSERQPP
ALSAKEVTLTSQGDETADEKPILPNTMCRLVRPGVGRLVLEDDKAIVYHCFDNSREYQGN
PISPMEFEMDDAASLEQLLTTVEPEWILVNDLFHDSIEDKIQIVQCLYDEGIIAVKQAE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgtggtcaaactatgataagggttgtacaattcgactgctacggcctcataagcactgt
gatgcgatccaatctctcttaagtacacttgaagttgaattccaatgtatgattggagca
aatgcatatttgacaccaccacgatcatcgcaggggttcgctccacattatgatgacatt
gatgcattttgccttcagttacaaggaagtaaacgatggaaggtttataaacctaccata
aaacttccacggaccagttcagaagattttacaacagaggatctcgaggatatggaacca
gttttagatataacgttaaatgaaggcgatctactatacatgccaagggggtatatccat
caggcatgtaccttaaacgacaacagtcatcattcgattcatttaactatttcggctatg
cagcaatgggcttgggttgacttgatggaaattgtggtacccgatgctttaaatgctgcc
gctatgagtgaatcttctactagccttcgaaagggactaccgcaaggctttatggagtat
atgggtgttatgtatgaagaacctaacgatgaaaaactccctgatactttaaaaatcgcc
ggtcaagaagaaaaaacggccaaaaagaggataatggaagtcgccgagactgcatgtaca
atgctcgatgcagcttgtgacgaaatggcaacgagatacatgtcggaacgacaacctcct
gcattgtctgccaaagaagttacactaacctcacagggagatgaaacagctgatgaaaag
cctattctaccaaatacgatgtgtcgattagttcgtccaggagttggaagacttgtacta
gaagatgataaggctatcgtctaccattgttttgataattccagagagtatcagggaaat
cctattagtccaatggagtttgaaatggacgatgcagcttccttagaacaactcttgact
acagtagaaccggagtggattctagtgaatgacttatttcatgatagtattgaggacaaa
atccagatcgtacagtgtctttatgacgagggaatcattgctgtcaaacaggccgaa

DBGET integrated database retrieval system