KEGG   Fragilariopsis cylindrus: FRACYDRAFT_147802Help
Entry
FRACYDRAFT_147802 CDS       T04784                                 

Definition
(GenBank) tryptophan synthase beta subunit-like PLP-dependent enzyme
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
fcy  Fragilariopsis cylindrus
Brite
KEGG Orthology (KO) [BR:fcy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FRACYDRAFT_147802
Enzymes [BR:fcy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     FRACYDRAFT_147802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP Ntox44 DNA_pack_C
Motif
Other DBs
NCBI-ProteinID: OEU23675
JGI: 147802
UniProt: A0A1E7FZW5
Position
Unknown
AA seq 476 aa AA seqDB search
YTSTRDATKFYTFEEALFSGYAKDGGLFVPEKLPQVNSTTLKEWSTLGYVDLSTEVLHPF
IGPGQISKLELKSLLERALLNGNAFDTTDDNLVPIVPIVKKRRTTTFNDHDDDEICRCYV
AELFHGPTYCFKDLGMRATIFLLDYFATKKNNDTANTNKSINKKVVLLASTTGDTGPAAV
QAVQDLNSPNLSIVIHYPSGQISDFQRKQMTTVQSSRVKIVSFEGGGDDLDRPIKRIITS
TTTKTKTKTKMATTDNGRDDDSNNTIICGVNSYNIGRPLMQMVHFIWTYLRVKEQHIKNE
NENENETKQKEDNFRLDIVIPTGAMGNIAGCYMAKKMGVPFGMLCAGVNINDITHRAFST
GIIQRPTEDENMKQSLSDAINIQLPYNLERLLFYLTNESHDQVKAWYDQLEEEAPSSSQA
GYKDVTTDWLNKLQTEFRSARVTDDQLCTTMKRVLEDYNYWVDPHTGVAFSAAEQL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
tatacatcaactagagacgcaacaaaattttatacgtttgaggaggcattattttctgga
tatgcaaaagatggtggtttgtttgttcctgagaaacttcctcaagtaaatagtactaca
ttaaaggaatggtcgacacttggttatgttgatttatcaacggaagtattgcatccattt
attggtccgggtcaaatatcaaaattagaattaaaatctttattagaacgtgcattatta
aatggtaatgcattcgatacgacggatgataatttagtaccaatagttcctattgttaaa
aaaagaaggacgacaactttcaatgatcatgatgatgatgaaatttgtcgatgttacgtt
gccgaattatttcacggtccaacttattgttttaaagatttaggaatgagagcaacaata
tttcttctagattattttgctaccaagaaaaacaatgatacagcgaacacaaacaagagc
ataaacaagaaggttgtattattagcaagtactactggtgatactggtccagctgctgta
caagcggtacaagatttaaatagtcctaatcttagtattgttattcattatccatctgga
caaatatctgattttcaaagaaaacaaatgacaactgtacaatccagtagagttaagatt
gtttcatttgaaggtggtggggatgatctggatcgtccaattaaacgtataataacatca
acaacaacgaaaacaaaaacaaaaacaaagatggcaactactgacaatggtagagatgat
gattcaaataataccataatttgtggtgtaaattcttataatattggtcggccattaatg
caaatggttcattttatttggacgtacctgcgtgtaaaagaacagcacataaaaaatgaa
aatgaaaacgaaaatgaaacgaaacaaaaagaggacaactttcggttagatattgttatc
ccgactggagctatgggtaatattgctggttgttatatggcaaagaaaatgggtgtacca
tttggtatgttgtgtgctggtgttaatattaatgatattacacatagagccttcagtaca
ggtattattcaacgaccaacagaagatgagaatatgaaacaatccttaagtgatgctatt
aatatccaattaccgtacaatttagaacgtttattattttatttaactaatgaaagtcat
gatcaagtaaaagcgtggtatgatcaattggaggaggaagcgccgtcatcgtcacaagca
ggatataaggatgtcacgacggattggttgaataaattacaaactgaatttcgttctgct
agggttacagatgatcaattgtgtacgacaatgaaacgcgtgttagaagactacaattat
tgggttgatcctcatacaggtgttgccttctctgcggctgaacagttg

DBGET integrated database retrieval system