KEGG   Fragilariopsis cylindrus: FRACYDRAFT_206890Help
Entry
FRACYDRAFT_206890 CDS       T04784                                 

Definition
(GenBank) Peptidase_M16-domain-containing protein
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
fcy  Fragilariopsis cylindrus
Brite
KEGG Orthology (KO) [BR:fcy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fcy01002]
    FRACYDRAFT_206890
Enzymes [BR:fcy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     FRACYDRAFT_206890
Peptidases and inhibitors [BR:fcy01002]
 Metallo peptidases
  Family M16: pitrilysin family
   FRACYDRAFT_206890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C NUDE_C
Motif
Other DBs
NCBI-ProteinID: OEU18328
JGI: 206890
UniProt: A0A1E7FJJ9
Position
Unknown
AA seq 1097 aa AA seqDB search
MSSTTESTEIEIEIPSVDKREYKHITLGNKDNGSCCKLDVLLISDIATDKASAAIDINIG
QLCDPILSPGIAHFLEHMLFIGTKKYPIENDYDSFLQKNGGSSNAFTDLEHTNYYFDIQH
NCLEGAFDRFAQCFIAPLFTESALEREVQAVDSEHAKNLMTDQWRLFQLSKTKLVNGNGS
GNSGENGHPFGGFGSGNAESLPTAPVVSGNGTHIREQLLDFFQVNYRKSLSLYKLVILGR
ESLDELEDMVQKYFGELVEIFEEKQEKLESSQVIVTKEMLRNELYPSPKHWYVPQRLHII
PISQIHSLELQFPIREIISLYQTKPTRYLSHLLGHEGKGSLLSYLKNQKQYVTELYADDG
SKSCHDFSIFTIHMELTLHGLTNVNEIITIVFGYIHLLQSEGPKEWIHNESQIISETQFQ
FLSQRNPMDYTCSLAGRMQNYPSNHYLSGPYKTFDTNNDWSSTTSTLIEECLNALNPDNM
LILLSSPTFDNDNGDEDNDKKEPSVCTEVEPWYGTKYSTIELLETSMNTWKSIQHTTYPE
LQLPEVNDMIATDLTLLHESNENDQPQCIHQDSNMTIWYKPDNVFDMPKVNIMIRFTSGQ
GSFSPHQSIAAQIFTELVEEQCNEFSYEATMAGLHCDISPSSGSGIELQISGYNHKAHVL
VEKLIDTIMDLLNNKEDNNDHITELFDRVKYKIEQSIQSFLVGQPYQHSIYGGDLILASQ
GTTTIDDKLIALNSITLQDVITFGNIFMKFCQLDSLVHGNVSAQHTYDIINMVWKKTRQQ
DGQQKQPEEASAVVEVVTPIIRTPLEKRVIQLNNSDSSSSSSSPSPSYLYRFAEFNEANT
NSCVAIILQMGILEMKSNAMLAFINHLIREPAFNQLRTEEQLGYIVHTSVKTSGDHIKGL
LVLIQSDSFNPNHVEERIELFLMNYRQKLVDMSESDFQTHVDAMVASFLEKNKNLGEESS
RYWHVILNKTYEFSRYKNLAEHVKMLKKLDMLRFYDKYVAMNAPCRRKLCVHVVAKQHED
EDEDGGGTAVAAETALAAADKEKKMGGEVEEMKEPEVKTDAAAVIRIDNPIDFRHSMPLY
PMPIKANVDVVDVGINK
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaaccactgaaagtactgaaattgaaattgaaattccatctgtggataaacgt
gaatataaacatattactttaggtaataaagataacggcagttgttgtaaattagatgtc
ttattaatatcggatatagccactgataaagcaagtgccgctattgatataaatattggt
caattatgtgatccaatactatcaccgggtattgcacattttttagaacatatgttattt
attggtactaaaaaatatcctattgaaaatgattatgattcattcttacaaaaaaatggt
ggttcgtcgaatgcctttactgatttagaacataccaattattattttgatattcaacat
aattgtttggaaggtgcctttgatcgatttgcacaatgttttatagcaccattatttaca
gaatcagcgttggagcgagaagttcaagcagttgattctgaacatgcgaaaaatttaatg
acagaccagtggcgattatttcaattatcgaaaacaaaattagtgaatggaaatggctct
ggcaatagtggtgaaaatggacatccatttggtggatttggttcagggaatgctgaatca
ttaccaacagctcccgtcgtctccggtaatggtacacatatacgtgaacaattattagat
ttttttcaagtaaactacagaaaaagtttatcattatataaattagtgatattaggacgt
gaatctttggacgaacttgaagatatggtacaaaaatattttggggaattagttgaaatt
tttgaagaaaaacaagaaaaacttgaaagttctcaagtaatagtaacaaaagaaatgtta
agaaatgaattatatccaagtccgaaacattggtatgtcccccaacgattacatattata
ccaatttcacaaatccattcattggaattacaatttccaattcgtgaaattatatcttta
tatcaaacaaaaccaacacgatatctatctcatttattaggtcatgaaggaaaaggttcc
ttgttgtcatatttaaaaaatcaaaaacaatatgtgactgaattatatgcggatgatgga
tcaaaaagttgtcatgatttttcaatttttactattcatatggaattaacattacatgga
ttgacaaatgtcaatgaaattattacaatagtatttggttatattcatttacttcaatca
gaaggtcccaaagaatggatacataacgagtcacaaattatatcagaaacacaatttcaa
tttttaagtcaacgtaatcccatggattatacatgttcacttgctggacgtatgcagaat
tatccatctaatcattatttaagtggtccctataaaacatttgatactaataatgattgg
tcatcaacaacatcaacattaattgaggaatgtttaaatgctcttaatccagacaatatg
ttaatcttactatcatcaccaacatttgataatgataacggtgatgaagataatgataag
aaggaaccatctgtatgtacagaagtggaaccatggtatgggacaaagtattcaacaatt
gaactacttgaaacatcaatgaatacatggaaatcgattcagcatacaacatatcctgaa
ttacaattgcctgaagtgaatgatatgattgcaacagatttgactttactgcatgaaagt
aacgaaaatgatcaaccacaatgtattcatcaagattctaatatgacaatttggtataaa
ccagataatgtatttgacatgccaaaagttaatattatgatacgtttcacatccggtcaa
ggttccttttcaccacatcaatccattgcggcacaaatatttacagaattagtagaagaa
caatgcaatgaattttcctatgaagccactatggctggattgcattgtgatattagtcca
tcctcaggatccggtatcgaattacaaatttctggttataatcataaagcacatgtactt
gtggaaaaattaattgatacaatcatggatttacttaataataaggaagacaataatgat
catattacagaattatttgatcgtgtgaaatacaaaattgaacaatctatacaatcattt
ctagttggtcaaccatatcagcattctatttatggtggtgatttaatattagcatcacaa
ggaacaacaacaattgatgataaattaattgcattaaatagcattacattacaggatgtc
ataacatttgggaatatatttatgaaattttgtcaattagattcattagtacatggaaat
gtatcggcacagcatacctatgatatcattaatatggtatggaaaaagacacgacaacaa
gatggacaacaaaaacaaccggaggaggcatcggcagtagtagaagttgttacaccaatc
attcgtaccccactcgaaaaacgagttattcaattgaacaatagcgattcgtcgtcgtca
tcatcatcaccatcaccatcgtacctgtatcggtttgctgaatttaatgaagcgaatact
aattcatgtgttgcaattattttacaaatgggtatacttgagatgaaatcaaatgctatg
ttagcatttatcaatcatttgattagagaaccagcatttaatcaattacgtaccgaagaa
caattaggttatattgtccatacgtctgtgaaaacaagtggtgatcacattaaaggatta
ttagtattaatccaatctgattcatttaatccaaatcatgtggaagaacggattgaacta
tttttaatgaattatcgacaaaaattagtggatatgtctgaatcagattttcaaactcat
gtcgatgctatggtagctagttttcttgaaaagaacaaaaatcttggtgaagaatcttct
cggtattggcatgttattcttaataagacgtatgaattctcgaggtataaaaatctcgcg
gagcatgtgaagatgttgaagaaattggatatgttacgtttttatgacaagtatgttgct
atgaacgcaccgtgtcgacgaaaactttgtgtccacgtcgttgcgaaacagcatgaagat
gaagacgaggacggtggtggtactgctgttgctgctgagactgctttggcggcagcagat
aaagaaaagaaaatgggaggagaagtagaggaaatgaaagaacccgaagtgaagacggac
gcggcagcagtgatccgtattgataatcctattgattttagacattcgatgccactttat
cccatgcctattaaggctaatgtggatgtagtcgatgttggaatcaacaaataa

DBGET integrated database retrieval system