KEGG   Fragilariopsis cylindrus: FRACYDRAFT_232706Help
Entry
FRACYDRAFT_232706 CDS       T04784                                 

Definition
(GenBank) NAD(P)-binding protein
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
fcy  Fragilariopsis cylindrus
Pathway
fcy00061  Fatty acid biosynthesis
fcy01100  Metabolic pathways
fcy01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fcy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FRACYDRAFT_232706
Enzymes [BR:fcy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     FRACYDRAFT_232706
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     FRACYDRAFT_232706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase GDP_Man_Dehyd 3HCDH_N 3Beta_HSD NAD_binding_7 Polysacc_synt_2 PCMT 2-Hacid_dh_C TrkA_N NAD_binding_10 Methyltransf_25 MTS Baculo_Y142 RmlD_sub_bind Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: OEU22548
JGI: 232706
UniProt: A0A1E7FWK7
Position
Unknown
AA seq 281 aa AA seqDB search
MASSWLQLAHKTCIVTGAGSGIGAAVAKSLISEGCRVVLADTNHDAIERVSKDLNTDTSN
FHLMQCDITDPNQVRDLIQQADEFAAKSTPAEQVGGIPSAATLLVNSAGITKDNWITQME
LDEWDDVLEVNLKGTFLTCREFMNQKRADVLFPKGPAADVESGTSSHCSSIVNIGSVVSE
LGNIGQVNYAASKGGIMGLTRALAKEVAIRNIRVNAVIPGFIDTPMAQEVPSHVKERVIN
RIPMQRFGSPVEVANVISFLLSPRSGYITGESISVSGMISL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatcttggctacaacttgctcataaaacatgtatcgtcacaggagctggtagc
ggtattggcgctgctgtcgctaagtcactgatatccgagggttgtcgcgttgttttggct
gatactaatcacgatgcaattgagagggtgtcaaaagatttaaataccgatacgtctaat
tttcatctgatgcaatgtgatatcacagatccaaaccaagtacgagatcttatacagcaa
gctgacgagtttgccgccaagtctactccagcagagcaggtcggcggcattccttccgct
gcaactcttctagtcaattccgctggcattacaaaagataattggataacacaaatggaa
ttggatgaatgggacgatgttttagaagtaaacctcaaagggacatttttaacctgtaga
gaatttatgaatcagaaacgagcagatgttctctttccgaaaggacctgccgccgatgtt
gaaagtggtactagtagtcattgttcctcaattgttaatatcggctctgtagtcagcgaa
cttggcaatataggtcaggttaactacgcagcaagtaaagggggcatcatgggtcttact
agagcattagcgaaggaagttgcaattcgaaacatccgtgtaaatgccgtaattccgggc
tttatagatacaccaatggcgcaggaggtaccttcgcacgtcaaagaacgtgtaattaat
cgtattcctatgcaaagattcgggtcacctgtcgaagttgcaaatgtaatttcgttcttg
ctctcaccaaggagtgggtacatcaccggggaatctatatccgttagtggaatgatatcg
ttgtaa

DBGET integrated database retrieval system