KEGG   Fragilariopsis cylindrus: FRACYDRAFT_269015Help
Entry
FRACYDRAFT_269015 CDS       T04784                                 

Definition
(GenBank) mitochondrial succinyl-CoA synthetase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
fcy  Fragilariopsis cylindrus
Pathway
fcy00020  Citrate cycle (TCA cycle)
fcy00640  Propanoate metabolism
fcy01100  Metabolic pathways
fcy01110  Biosynthesis of secondary metabolites
fcy01130  Biosynthesis of antibiotics
fcy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FRACYDRAFT_269015
   00640 Propanoate metabolism
    FRACYDRAFT_269015
Enzymes [BR:fcy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     FRACYDRAFT_269015
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FRACYDRAFT_269015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: OEU16475
JGI: 269015
UniProt: A0A1E7FEJ7
Position
Unknown
AA seq 321 aa AA seqDB search
MNKSSAFASKIATAVSRPSASRSMSSTAKVWVDKNTRVICQGFTGKQGTFHSTQAIEYGT
NMVGGVTPNKGGQEHLGLPVFNTVAEAVDELKPDASVIYVPPPFCAAAIMDAIEAEIPLV
VAITEGVPQQDMARVKYALRQQSATRLIGPNCPGIIKPGECKIGIMPGYIHTKGKIGVVS
RSGTLTYEAVHQTTIAGLGQSTVVGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGG
NAEEEAAEWLKEYGDPNKPVVGFIAGTTAPPGRRMGHAGAIVAGGKGGAAEKFEALESAG
VHISRSPAQLGNTMLKAMGLA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagtagtgcattcgcgtccaaaatagcgactgcggtctcccgacccagtgct
tctcgatccatgtcatccactgcgaaagtatgggtcgataagaatacgagagttatctgt
caaggatttaccggaaaacagggaacgtttcactctactcaagctatcgaatatggaacc
aatatggtaggaggagtaacaccaaataagggtggccaggaacatcttggtctacctgtt
ttcaacacggtcgctgaagcggttgatgaacttaaacctgatgctagtgtcatttatgtt
ccccctccattttgtgctgcggctatcatggatgctattgaagctgaaatcccattggta
gttgctatcactgagggtgtcccgcaacaagatatggctagagttaaatacgctctccga
caacagtccgcaacacgtttaattggacctaactgtcctggtattatcaaaccaggtgaa
tgtaagattggtatcatgcctggatatattcacacaaaaggaaagattggtgtcgtatct
agaagtggtacactcacgtatgaggcagtccatcaaacgaccattgcaggattaggtcaa
tcgacagttgtaggaattggaggagatccattcaatggtactaacttcattgattgtttg
gaacgttttaccaatgatcctgaaacagaaggaatcattatgattggtgaaattggtggt
aacgcagaagaggaagctgctgaatggcttaaggagtatggtgatccaaacaagccagtt
gttggtttcattgctggaacaactgcaccaccaggtcgtcgtatgggccatgctggagct
atcgtagcgggaggtaaaggtggagccgctgaaaaatttgaagcattggaatctgctgga
gtacacatttctcgatctcctgcgcaactaggaaataccatgctaaaggcgatgggtctt
gcttga

DBGET integrated database retrieval system