KEGG   Fragilariopsis cylindrus: FRACYDRAFT_275149Help
Entry
FRACYDRAFT_275149 CDS       T04784                                 

Definition
(GenBank) PLP-dependent transferase
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
fcy  Fragilariopsis cylindrus
Pathway
fcy00564  Glycerophospholipid metabolism
fcy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FRACYDRAFT_275149
Enzymes [BR:fcy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     FRACYDRAFT_275149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: OEU17597
JGI: 275149
UniProt: A0A1E7FHI2
Position
Unknown
AA seq 425 aa AA seqDB search
MKCVSISYANSDDGGLMMMQGIGSRLIDETGTSYLDTRNNVCHVGHCHPKVVEAVSRQLA
TLNTNTRYLHPNVCELAERLCAKCPEPLEKVVFVNSGSEANDLALRLARAYTSSKNTIVI
DGGDGDGPYDNYMTPGRHIWKCPCPDTYRGLHCDDDAGEKYAEYVQTACNYYTSNEESVG
AIIMEGGMSVGGVILPPDDFIRNSVDMVRKTGGVFIADEVQTGFGRLGSTFWAFEQGNHG
VVPDIVTVGKPFGNGISLGAVIMTRAIADHFDDMGVEYFNTFGGSPVAAAAGLAVLDVME
EERLQDHALEVGKYLIASFWQVQDRILSDCNFLIGDIRGSGLFLGIELVRNGETKEPAAI
ETSFLCTILKQKYHILTSIDGLHENVLVIKPPLVFSKEDADYFVQSFSKASQEVNSLTRS
ELTAM
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtgttagtatttcgtacgccaactctgatgatggtggtcttatgatgatgcaa
ggtataggttcaagattaatagatgaaaccggaacgtcatatcttgatacgcggaataat
gtttgtcatgtcggtcattgtcatccaaaagtagttgaagctgtttctcgacaattggca
actcttaatacgaacacaagatatctacatccgaatgtatgcgagttggctgaaagatta
tgtgcaaagtgtcctgaaccattagaaaaggttgtttttgtgaatagtggctcggaagcc
aacgatttagcattacgtctagctcgagcttatacatcatctaaaaatacaattgttatt
gacggaggtgatggtgatggaccatacgacaactacatgacacctggacggcacatctgg
aaatgtccttgtcctgatacgtatcgggggcttcattgtgatgacgatgctggagaaaaa
tatgctgaatacgttcaaacggcttgtaactattatacgtcaaacgaagaatcagtcggt
gctattatcatggagggtggcatgagtgtaggaggtgtaattttaccacctgatgacttt
attcggaacagcgtagatatggttcggaagacaggaggggtgtttattgctgatgaggta
caaacaggttttggaaggttaggaagtacgttttgggcatttgagcaagggaatcatggt
gtagttcccgatatcgtaacagtaggaaagccttttggtaatggaataagtcttggtgct
gtgatcatgactcgtgccattgctgatcattttgatgatatgggtgtagagtattttaat
accttcgggggttcgcctgtagcggccgcggcaggcttagccgtgcttgatgtcatggaa
gaagaaagactacaagatcacgcattagaagtgggaaagtatctgatagcaagcttttgg
caggtgcaagatcgaatattgtcagattgtaattttttgatcggtgatattcgaggaagt
ggattatttcttgggattgaactggtacgcaacggagaaacgaaggaacctgctgcgata
gaaacatccttcctttgtactatactgaaacaaaagtatcatatcctcactagtattgat
ggccttcatgagaatgttttagtaatcaaacctccattggttttctcaaaagaagatgct
gattacttcgttcagtccttttccaaagcatcacaagaagtgaattcgttgacaagaagt
gagcttactgccatgtag

DBGET integrated database retrieval system