KEGG   Fragilariopsis cylindrus: FRACYDRAFT_277329Help
Entry
FRACYDRAFT_277329 CDS       T04784                                 

Definition
(GenBank) DAGK_cat-domain-containing protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
fcy  Fragilariopsis cylindrus
Pathway
fcy00600  Sphingolipid metabolism
fcy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    FRACYDRAFT_277329
Enzymes [BR:fcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     FRACYDRAFT_277329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-ProteinID: OEU09515
JGI: 277329
UniProt: A0A1E7EUN4
Position
Unknown
AA seq 536 aa AA seqDB search
MSNDEDDVEWPREVAERNQRLLTVVSGSSDAEENTVDIIDPNDIVGVNVEIELASTGISE
PRSLTSSLNRNDDSNQNNEPVSEIPVDTQANAILSLFVYPKPNLSTKGYIQTFCGAERNK
TKNSNKAITFLEDKDRRQDCSDASKSSKCIGQRYCHHRRFTVAPSEDLTDLSILVNAIRK
LSQPNKLPATSLDEEERLLVIVNPCSGQKMGVSEYEKMLLPMLEEAGVAHDCLITTHTKH
AEERMRKQCTPSDFKDVSKYTGIVVVGGDGTIHEIMQGIHQRDDRDKILESIKLGMIGAG
TSNGFSASLAHASKESMSPLDSAFVIVKGMSSWIDLSRYDTKSSSYTSFLTFSWAMIADI
DIESECIRWAGFLRMDIWGVVRVLFLRKYRAKFSYLPPTEDKKTVILPPLSTPLSENEGW
VTVEDDFVLFWVSQVTHAGEQMFQSPSCKMNDGVFQIFVVRGNVSRLRLALILLAMEHGG
HVGMNGVEFIQCSAYRLEPITQGSYNDLDGEVIESGPIQASVLPSSIQAYSNPQYD
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgatgaagatgacgtcgaatggccgagagaagtggcagaaaggaatcaacga
cttctcactgtcgtctctggaagtagtgatgcagaagaaaatacggttgatattattgac
ccaaatgatattgtaggtgttaatgtagaaattgaactggcatctactggcatatcggaa
ccgagatctcttacctcttctctcaataggaacgacgacagcaaccaaaacaatgaacca
gtctcagaaattccggttgatactcaagctaatgcaattttgtctctattcgtttatcca
aaaccaaatttgagcacgaagggatatatccaaacattttgtggtgcggaacgaaataaa
acaaaaaatagtaacaaggcaatcacgtttctggaagataaagatcgacgacaagattgt
tccgatgcatcgaaatcctccaaatgtataggtcaacgctattgtcaccatcgtcgcttc
accgttgcaccctctgaagaccttaccgatctttcgatattggtgaatgcgattcgaaaa
ctgtcacaacctaataagttaccagcaacgtcgcttgacgaagaggaacgcttgcttgtc
atcgtcaatccctgttcgggccaaaaaatgggtgttagcgagtatgaaaagatgttgctt
cctatgttggaagaagccggagttgctcatgattgtttgattacgactcatacaaaacac
gcagaagaaagaatgaggaaacaatgtacaccttcagatttcaaagacgtttccaaatat
acgggcatagtagtcgttggaggggacggtactatacatgaaataatgcagggtatccac
caaagagacgacagagacaaaattctagaaagtatcaaattgggcatgatcggagctgga
acatccaatggtttttctgcgagcttggcccatgccagtaaggaaagtatgtcgcccttg
gactccgccttcgtgattgtcaaagggatgtcttcctggatcgatctctcaagatatgac
accaaatcttcctcatacacatcctttctaaccttcagttgggctatgatagcagatatt
gatattgaatcagaatgtattcgctgggcgggtttccttcgaatggacatatggggggtt
gtaagggtgttatttcttcggaaatatcgtgcaaagttctcctatctccctcctaccgaa
gacaaaaagacagtaatactgcctccattaagtacacccctatcagaaaatgaaggatgg
gtcacagtagaggatgactttgttctattttgggtatctcaagtaacccatgctggggag
caaatgttccaatctccttcatgcaagatgaacgatggagttttccaaattttcgttgta
cgtggaaatgtttcaagactgcgattagccctgatccttttggctatggaacacggtggc
cacgttggaatgaacggagtggaattcatacaatgctctgcctatcgtctagaacccata
actcagggctcatacaatgaccttgatggtgaagtcattgagtctggtcctattcaagca
tcagttttgccgtcttccattcaagcatatagcaatccgcagtatgattga

DBGET integrated database retrieval system