KEGG   Flavivirga eckloniae: C1H87_00040Help
Entry
C1H87_00040       CDS       T05284                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fek  Flavivirga eckloniae
Pathway
fek00260  Glycine, serine and threonine metabolism
fek01100  Metabolic pathways
fek01110  Biosynthesis of secondary metabolites
fek01120  Microbial metabolism in diverse environments
fek01130  Biosynthesis of antibiotics
fek01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fek00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C1H87_00040
Enzymes [BR:fek01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C1H87_00040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_3 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AUP77192
UniProt: A0A2K9PJI3
Position
8851..9864
Genome map
AA seq 337 aa AA seqDB search
MTIDLRSDTVTKPTKDMLDAMMQAKVGDDVFREDPTVNELEQRIANMFGKSDALFFPSGT
MANQTALKLHTNPGDQVICDKYAHIYNYESGGASFNSGISCKLIDGNRGMFKAEQVLEAI
NPEAYYYSLTSLVEIENTTNKGGGACWDFNEIKKIRTICDENSLGFHLDGARLWNALVAK
NETTEQYGEVFDTISVCLSKGLGCPIGSVLVGDADIMKHAIRIRKIFGGNMRQAGYLAAA
GLYALDHNIERLAEDHKKAKEIGETLSNLSMIKTVEPVETNIVIFELNADVNENTFVQKL
AAKNIHIISMGSNKLRMVTHLDYTNAMHDKLLSTLRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgacctaagaagcgataccgttacaaaaccaacaaaagatatgcttgatgct
atgatgcaggcaaaagttggtgatgatgtgtttagagaagacccaactgttaatgaattg
gagcagcgtatagcaaacatgttcgggaaaagtgatgctctgtttttccccagcggaact
atggcgaaccaaacggcattgaaactgcatacaaatcccggagatcaggttatttgcgat
aaatacgcccatatttataattatgagtctggtggcgcttcttttaatagtggtatttcc
tgtaaacttatagatggtaacagggggatgtttaaagccgaacaagttttagaggcaata
aaccctgaggcttattattatagtcttacaagtttggtagagattgaaaacaccacaaat
aaaggaggtggtgcatgttgggattttaacgaaataaaaaaaataagaaccatttgcgat
gaaaacagtcttggatttcatctggacggtgcgcgcttatggaatgctttagtggctaaa
aatgaaacgacggagcaatacggagaggtgttcgatactatttcggtatgcttaagcaaa
ggtttaggatgtcctataggctctgttctggtaggtgatgcagatattatgaaacatgct
atacgcattagaaagatttttggaggtaatatgcgacaggcgggttatttggctgctgca
ggactttacgccttagatcacaacatagaaagactagcggaagatcataagaaggcaaaa
gaaataggagagaccctttctaacttatccatgataaaaacagttgaaccggttgaaacg
aatatcgtaatttttgaattaaacgcagacgtaaatgaaaatacctttgtacaaaaatta
gcagccaaaaacatccacattataagtatgggaagtaacaagctacgaatggttacgcat
ttagactatacaaatgcgatgcacgataaacttttgagtacactacggagctaa

DBGET integrated database retrieval system