KEGG   Flavivirga eckloniae: C1H87_01515Help
Entry
C1H87_01515       CDS       T05284                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
fek  Flavivirga eckloniae
Pathway
fek00790  Folate biosynthesis
fek01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fek00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C1H87_01515
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fek04147]
    C1H87_01515
Enzymes [BR:fek01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     C1H87_01515
Exosome [BR:fek04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C1H87_01515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AUP77468
UniProt: A0A2K9PKU2
Position
367928..368218
Genome map
AA seq 96 aa AA seqDB search
MSKLSENDIEKRLLHLPDWDYYDNAIHAEFEFDNFKDCFSAMSRIAFECEALNHHPNWSN
VYNVLTISITTHDANGLTNKDFKLAEAIDTIVEPEE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaactttcagaaaatgatatagaaaaaagactattgcaccttccagactgggat
tattacgataatgctattcatgccgagtttgaattcgataattttaaagattgctttagt
gccatgagcagaattgccttcgagtgcgaagcattgaatcatcatcctaattggtctaac
gtatataatgtacttaccatttcgataacaactcatgatgctaatggcttaactaataaa
gacttcaaactagcagaagctatcgatactatagttgaacctgaggagtga

DBGET integrated database retrieval system