KEGG   Flavivirga eckloniae: C1H87_06800Help
Entry
C1H87_06800       CDS       T05284                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
fek  Flavivirga eckloniae
Brite
KEGG Orthology (KO) [BR:fek00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C1H87_06800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AUP78432
UniProt: A0A2K9PMZ9
Position
1606303..1606689
Genome map
AA seq 128 aa AA seqDB search
MVQQITKGIKISVVTTFEGSFYKNYKMQYAFGYTITIENQSKDSVQLNARHWEILDALNN
VETVSGEGVIGKKPVLKPGESHTYSSGCLLTSPFGAMQGHYSMVNFTTTKKFKVTIPTFS
LSAPFAIN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggttcaacaaattacaaaaggtataaagatatcggtggttaccacctttgaaggctcg
ttttataagaattataaaatgcagtatgcttttggatatacaataactattgaaaatcaa
agtaaggattctgtacaacttaatgcacgccactgggaaattttagatgcattaaataat
gttgaaactgtttctggcgaaggtgttattggtaaaaaaccagtattgaagcccggtgaa
tcacatacgtattcttccggatgtttgctaacgtctccttttggtgctatgcaaggccat
tacagcatggtaaactttactactactaaaaagtttaaagtaaccatacctacctttagc
ttaagtgctccttttgctattaattaa

DBGET integrated database retrieval system