KEGG   Flavivirga eckloniae: C1H87_08780Help
Entry
C1H87_08780       CDS       T05284                                 

Definition
(GenBank) thiamine biosynthesis protein ThiJ
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
fek  Flavivirga eckloniae
Pathway
fek00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:fek00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    C1H87_08780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fek01002]
    C1H87_08780
Enzymes [BR:fek01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     C1H87_08780
Peptidases [BR:fek01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   C1H87_08780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI GATase
Motif
Other DBs
NCBI-ProteinID: AUP78788
UniProt: A0A2K9PPN4
Position
2131626..2132210
Genome map
AA seq 194 aa AA seqDB search
MKIAYILFDDITLLDFIGFYDPIKNIKTKGFIENLSWDLCATKKSIKDSFGLEIVVDKIK
PDLSNYDMIVVPGGYGTRELQYNTEFIEWLKTGEHVDYIVSICTGSLLIGAAEFLKGKTA
TTNFNEYKALEKYCAKVAQTRIVDDKNTITAGAVASSLDLGLYICEKLLGKEKAEEICIG
MDYHPKPFEIITVT
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcatatatactttttgacgacataacgcttttagattttatcgggttttac
gaccctataaaaaacataaaaaccaaagggtttatagaaaatcttagttgggatttgtgt
gctaccaaaaaatcgataaaagatagttttgggctagaaatcgttgttgataaaattaaa
cctgatctatcaaattacgatatgatcgtcgttcccggtggatatggcacaagagaactc
caatacaacacggaattcattgaatggttaaaaactggagaacatgtagattatattgtt
tcaatctgtacaggtagtctattaattggtgctgctgaatttttaaaaggaaaaacagct
acaaccaactttaatgaatacaaagccttggaaaaatattgcgcaaaagtggctcaaacc
agaatagttgacgataaaaataccataacagcaggcgctgttgcctcttcgttagactta
ggcttgtatatatgcgagaaactcttaggaaaagaaaaagctgaagaaatatgtattgga
atggactaccatccgaaaccattcgaaataattaccgtgacttaa

DBGET integrated database retrieval system