KEGG   Flavivirga eckloniae: C1H87_22305Help
Entry
C1H87_22305       CDS       T05284                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
fek  Flavivirga eckloniae
Pathway
fek00860  Porphyrin and chlorophyll metabolism
fek01100  Metabolic pathways
Module
fek_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:fek00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C1H87_22305
Enzymes [BR:fek01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     C1H87_22305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase SNO
Motif
Other DBs
NCBI-ProteinID: AUP81301
UniProt: A0A2K9PW53
Position
5414873..5416336
Genome map
AA seq 487 aa AA seqDB search
MQNLHPIMLVGTGSDVGKSWITTGICRWLKQKGYQPAPFKAQNMSLNSFSTPDNLEIGRA
QAVQAEACEIPPTVEMNPILLKPSSVNKSQVVLHGKPIGNQTAQEYFLGEDKKHLFEEAK
KAFHQLATKYNPVVMEGAGSISELNLKHRDIVNMRMAAAANACVYLVADIDKGGVFGSVY
GTIELLEDWERKLVKGIIINKFRGDPTLFIEGKKKLEDITGLPILGIMPYAKDIIIEEED
SVALGSRAVTSRENKLNIAVVKLHYMSNYTDFQSLEQEPLINLYFTRDSEELKKADIIIL
PGTKNTIEDLIALKSDGLATIIKEQYKHIPIIGICGGYQMLGKSIADPFSVESNTTLEKG
LNIFDIETTLSKTKETVQRQFKFKDLKETCEGYEIHMGETNVPKNKHLNDVNGKEEGYFD
GNKSWGTYLHGIFDNQEVVTELLQVKYPDAKARNYKSFKAEQFDKLAHWIDENLDMATIL
KNSIEKC
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatctacaccctataatgctagttggaactggttcagatgttggtaaaagttgg
ataacaacagggatttgtagatggcttaaacagaaaggatatcaacctgccccttttaag
gcgcaaaatatgtctttaaatagtttttcgacaccagacaatcttgaaataggaagagcg
caagcagtacaagcagaagcgtgtgaaattcctccaacggtagagatgaaccctatatta
ttaaaaccttcatcagtaaacaaatcacaagttgtattacatggtaaacctataggcaac
caaacggcacaagagtactttttgggagaggacaaaaagcatcttttcgaagaagctaaa
aaggcgtttcatcaattggcaacaaagtacaatcccgttgtaatggaaggcgcggggagt
attagcgaactcaacctaaaacatagagatatagtaaacatgcgaatggcagcagcagca
aatgcttgcgtttatttggtcgcagatattgataaaggcggtgtgtttggcagtgtatat
ggtacgattgagttgcttgaagattgggaacgaaaactggtaaaagggatcattattaat
aaatttagaggggatcctacactatttatagaaggcaaaaaaaaattagaagacattaca
ggtttgccgattttaggcattatgccttacgctaaagatattattatagaagaagaagat
tcagttgcgcttggctcaagagcggtaacttccagagagaataaattaaatattgctgta
gtaaaacttcattatatgtctaactacaccgattttcaatccttagaacaagaaccttta
atcaatctttattttacgagagattcagaagaattaaaaaaagcagacatcattattcta
ccgggtacaaaaaatacgattgaagatttaatagccttaaagtccgatggattggcaaca
ataattaaggaacaatacaaacacattcctattattggaatttgcggaggctatcaaatg
ctaggaaaatcaattgccgatcctttttctgttgaaagcaatactactttagaaaaaggc
ctgaatatttttgatatagaaacaacactttcaaaaacaaaagaaaccgtacaacgtcag
tttaaatttaaagatttaaaggagacttgcgaaggttatgaaattcacatgggagaaaca
aatgttccaaaaaacaaacatttaaacgatgtaaatggtaaagaagaaggctattttgac
ggaaataaaagttggggtacctatcttcacggaatttttgataatcaagaagtcgttaca
gaattacttcaagtaaaatatcctgatgccaaagctagaaactacaaatcatttaaagcg
gaacaatttgataaattggcacattggattgatgaaaatttagacatggcaaccatctta
aaaaatagcatagaaaaatgttaa

DBGET integrated database retrieval system