KEGG   Flavivirga eckloniae: C1H87_22860Help
Entry
C1H87_22860       CDS       T05284                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
fek  Flavivirga eckloniae
Pathway
fek00270  Cysteine and methionine metabolism
fek00480  Glutathione metabolism
fek01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fek00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    C1H87_22860
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C1H87_22860
Enzymes [BR:fek01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     C1H87_22860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATP-grasp_3 ATPgrasp_YheCD ATPgrasp_ST TxDE
Motif
Other DBs
NCBI-ProteinID: AUP81403
UniProt: A0A2K9PWH4
Position
5568639..5569676
Genome map
AA seq 345 aa AA seqDB search
MNVCFIMYPWEEINPETDTSLTLIKECVKRKHGVAICSPANLTIRNSVTSASCMVVGRME
KTPSSSKSFYNKAELREEMLPLAGFDVIFFRANPPLDPIMLNFLDSVKDDVFIMNSLEGM
REANNKLYTAAFGDAHSNIIPATHVSKSKKYLIRQIKESTADKMILKPLNGFGGSGVILI
EKSAMSSINSLLDFYINNSNGTSNYVILQDYIEGADEGDVRILILNGEPVGAMKRVPGTD
DHRSNVSAGGSVQKHSLTKAEKALCKQIGPKLVNDGLYFVGIDVIGGKLIEVNVMSPGGI
TYINKVYKLKTKIEEKVIDFLEMKVLDKLQAFDRRTRLRKTVQDA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgtgttttataatgtatccttgggaagagattaatcccgaaaccgatacatcc
cttactttaattaaagaatgcgttaaaagaaaacatggtgtggccatatgttcaccagct
aatttaaccattagaaatagtgtaacaagtgcgtcttgtatggtggtaggtagaatggaa
aaaacacctagttcctcaaaatcgttttataacaaggcagaattaagagaggaaatgctt
ccgttagcggggtttgatgtaatattttttagagcaaacccacctttagatcctattatg
cttaactttttagattcggttaaagacgatgtttttattatgaattccctggaaggtatg
cgtgaagccaataataaactctatacagcagcctttggagatgctcatagcaatattatt
ccggctacccatgtatcaaaaagcaaaaaatatttaatacgtcaaataaaagaatccaca
gccgataaaatgattcttaaacctttgaatggttttggagggtctggagttattttaatt
gaaaaatcggcgatgagtagtatcaattcattattggatttttatatcaataatagcaac
ggaacatcaaactatgtgattcttcaggattatattgagggggcagatgaaggagacgtg
cgtattttaattttaaatggcgaaccggttggtgctatgaaacgtgttccgggtacagac
gatcaccgctctaatgtctcagcaggaggtagcgtgcaaaaacacagtttaacaaaagca
gaaaaagccttatgtaagcaaataggtccaaaattggtaaatgacggactttactttgtg
gggatagatgttattggaggtaagttaatagaagttaatgtgatgtctccaggaggtatt
acctatattaacaaggtttacaagcttaaaactaaaatagaggaaaaggttatcgacttt
ttagaaatgaaagttttggataaactccaggccttcgatagacgaactagacttagaaag
actgttcaggatgcttag

DBGET integrated database retrieval system