KEGG   Ferrovibrio terrae: FNB15_00395Help
Entry
FNB15_00395       CDS       T06089                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
fer  Ferrovibrio terrae
Pathway
fer00480  Glutathione metabolism
fer00590  Arachidonic acid metabolism
fer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fer00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    FNB15_00395
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FNB15_00395
Enzymes [BR:fer01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FNB15_00395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: QDO99571
UniProt: A0A516H768
Position
83180..83674
Genome map
AA seq 164 aa AA seqDB search
MTAHDFELTGIDGTPMPLKQYKGKVVLLVNTASQCGFTPQYADLEKVYKQYRQRGLVVLG
VPSNDFGGQEPGTAAQIKEFCEVNFDIDFPLTEKQAVKGPQAHPLYRWIAAELGEDALPK
WNFHKYLIGADGRLIEGFATPVKPTDAKVTTAIEIALLKAKAGA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcatgatttcgaactgaccgggatcgacggcacgccgatgccgctgaagcag
tacaagggcaaggtggtgctgctggtcaacaccgcctcgcaatgcggcttcaccccgcaa
tatgccgacctggaaaaggtctataaacagtatcgccagcgcggcctggtcgtgctcggc
gtgccgtcgaacgatttcggcggccaggagccgggcaccgcggcgcagatcaaggaattc
tgcgaggtgaatttcgacatcgatttcccgctcactgagaagcaggccgtgaagggtccg
caggcgcatccgctctaccgctggattgccgccgaactgggcgaggacgcgctgccgaaa
tggaatttccacaaatacctgatcggcgccgacggccggctgatcgagggctttgccacg
ccggtgaaaccgacggatgccaaggtcaccaccgccatcgaaatagccctgctcaaggcg
aaggccggggcttga

DBGET integrated database retrieval system