KEGG   Flavobacterium faecale: FFWV33_04075Help
Entry
FFWV33_04075      CDS       T05515                                 

Definition
(GenBank) NAD(P)H nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
ffa  Flavobacterium faecale
Pathway
ffa00633  Nitrotoluene degradation
ffa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ffa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    FFWV33_04075
Enzymes [BR:ffa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     FFWV33_04075
  1.-  
   1.-.-  
    1.-.-.-  
     FFWV33_04075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AWG20774
UniProt: A0A2S1LAM4
Position
complement(937552..938205)
Genome map
AA seq 217 aa AA seqDB search
MNLTTILNNRYSVKEFDATKKISEADFQQVKDVLRLSPSSVNLQPWHFLIADTAAGKERI
AKGTQGFFHFNTPKVLDASHVIVIAARTNADDAYMNSILEQEDKDGRFAAQQFKDQMHGG
RMLFADIHKYDLKDLPHWMEKQVYLNMGSLLLGVAALGIDACPMEGVDVKALDEEFGLRE
KGYTALAVVSLGYRKDTDFNASLPKSRFSEEEVITIL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaactacaattttaaacaaccgttactctgtaaaagaatttgatgcaactaaa
aagatctcagaggcagatttccaacaagtaaaagatgtattgcgtttgagtccttcaagt
gtaaacttacaaccttggcattttttaattgcagacactgcagcaggaaaagaacgtatt
gcaaaaggaacacaaggtttctttcattttaatacaccaaaggttttagatgcctctcat
gtaattgttattgcagcgcgaacaaatgccgatgatgcctatatgaatagcattttagag
caagaagataaagacggtcgttttgcggctcaacaatttaaagaccaaatgcacggtggg
cgtatgttgtttgcagatattcataaatacgaccttaaagatttaccacattggatggaa
aaacaagtttatttaaatatgggttcccttttattaggagttgctgcattaggaattgac
gcttgcccaatggaaggtgtagatgtaaaagctttagacgaagagtttggtttacgtgaa
aaaggatatactgctttagctgtagtgtctttgggatatagaaaagataccgattttaat
gcaagccttccaaaatctagattttcagaagaagaagtaatcaccatcttataa

DBGET integrated database retrieval system