KEGG   Flavobacterium faecale: FFWV33_14385Help
Entry
FFWV33_14385      CDS       T05515                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
ffa  Flavobacterium faecale
Pathway
ffa00620  Pyruvate metabolism
ffa00630  Glyoxylate and dicarboxylate metabolism
ffa01100  Metabolic pathways
ffa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ffa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FFWV33_14385
   00630 Glyoxylate and dicarboxylate metabolism
    FFWV33_14385
Enzymes [BR:ffa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     FFWV33_14385
    1.2.1.22  lactaldehyde dehydrogenase
     FFWV33_14385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 OmdA
Motif
Other DBs
NCBI-ProteinID: AWG22629
UniProt: A0A2S1LFZ6
Position
complement(3366267..3367724)
Genome map
AA seq 485 aa AA seqDB search
MNQNIQHYKCYINGEWLDSSTRDSIKVENPANLEVFATVTACSKEDVQYALESSEKAQLA
WQLTPAHQRALYLFAIADKLKEERDHFAKLLVLEQGKTFPEAQGEVDGTIQYLTYNAEAA
RRIQGSMFPSENKNEHLAIYKVPYGVTVGLCAFNFPLALIGRKVGPALVTGNTMIIKPHE
LTPVTASEFCRLVHEVGVPKGVVNMVVTQNAEAASLLVESPITKLVSLTGSTRAGRGIYK
AVAHNVTALTLELGGKAPFIVCDDADIEKAVEAAAISRYANCGQVCICNEMVMVDEKIAD
EFTDKLIKRVKEIKVGDPFDSSVNMGPGVSSLGMERIDGLVKKNIEQGAELVLGGKRPDG
AMFEKGNWYEPTILTNVKNDHVTMQEEIFGPVLPIMKVSGFEEALALTNAREEGLSAYLY
TNNYKRHMTAIDQMQVGTIFINRGIVGYIQGYHSGHKTSGIGGEDGIYGIEGFLQKRTVY
LDYND
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaaatattcaacattacaaatgttacatcaacggagaatggttagattcttcg
actcgcgatagtattaaagtagaaaatccagctaatctggaagtttttgcaacggtaacc
gcttgttcgaaagaagatgtgcaatacgccttagaatcttcagaaaaagcccagctcgca
tggcaattgacaccagcacaccagcgtgcgttatatttgtttgctattgctgacaaattg
aaagaagagcgcgatcactttgccaaactattggttttagagcaaggaaaaacatttcca
gaagcacaaggcgaagtagatggaacgattcagtatttaacatataatgccgaagccgca
cgtcgaattcaaggttctatgtttccttctgaaaacaaaaacgaacatttggcgatctac
aaagtaccttacggagttactgtaggtttgtgcgcgtttaattttcctttggctttgatt
ggtcgaaaagtaggaccagctttggttacaggaaatactatgattattaaaccgcatgaa
ttgacaccagtcacggcatcagaattttgtcgtttggtgcatgaagtaggggttccaaag
ggagtggtgaatatggttgtaactcaaaatgcagaagcagcttcgttattagttgaaagt
ccgattaccaaattggtgagtttaaccggtagcacgcgcgctggaagaggaatttacaaa
gcagtagcgcataatgttacggctttgacattagaattaggaggaaaagcaccttttatt
gtttgtgacgatgccgatattgaaaaagcggtcgaagcagcagctatttctcgctacgct
aactgtggacaagtttgtatttgtaacgaaatggtgatggttgatgaaaaaatcgccgat
gagttcaccgataaattaatcaaaagagtgaaagaaattaaagtgggtgatccattcgac
tcttctgtaaatatggggcctggagtaagttcgttaggtatggagcgcattgatggcttg
gtgaaaaagaatattgagcaaggagcagaattggttttgggtggaaaacgtcctgatgga
gcgatgttcgaaaaaggaaactggtacgaaccaactattttgacaaacgttaaaaacgat
catgttaccatgcaagaagagatatttggtccagttttgccaattatgaaagtttctggt
tttgaagaagctttggctttgaccaatgctcgtgaagagggactatctgcatatctatat
accaacaactacaagcgccatatgactgcgattgaccaaatgcaagtaggaacaatattt
attaatcgtggaattgtaggctacattcaaggataccattcaggtcacaaaacttcggga
ataggaggagaggacggcatttatggtattgaaggtttcttgcaaaaaagaacagtttac
ctagattacaacgattaa

DBGET integrated database retrieval system