KEGG   Fervidicoccus fontis: FFONT_0964Help
Entry
FFONT_0964        CDS       T01936                                 

Definition
(GenBank) hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
ffo  Fervidicoccus fontis
Brite
KEGG Orthology (KO) [BR:ffo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ffo03016]
    FFONT_0964
Enzymes [BR:ffo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     FFONT_0964
Transfer RNA biogenesis [BR:ffo03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    FFONT_0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-ProteinID: AFH42952
UniProt: I0A1U5
Position
complement(919420..920025)
Genome map
AA seq 201 aa AA seqDB search
MLVADVNVWKNKKTMFIKRIESDREIGYLDPGIDETLSLINKREKSYTTSSCSGRISIVD
TDYLWKRNELPLIFKKHSEVSSEELISIFKKEPMNTFWLIVSGPILHVRTLDIEEALFIL
NAGREAGFKHSGIMSYSEDGYLVELISGTQFNFPIKNKNGYLINIEKIDYIAKLANSALV
DGRRKLEKLNQFLKEKENEIR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttgcagatgtcaatgtttggaaaaataaaaaaacgatgttcatcaaaaggatc
gaaagtgatagagagataggatatttagatcctgggatagatgagactctatccctaatt
aacaaaagagagaagagctatactacaagctcctgctcaggacggatatcgattgttgat
acagattatttatggaaaaggaatgagcttcctttaatatttaaaaaacattctgaggtt
agctctgaagaattaatttcaatatttaaaaaagaacctatgaatacattttggcttatc
gtaagcggtccaatacttcatgtgagaactttagacattgaagaagcgctttttatttta
aatgcgggtagggaggcaggatttaagcattcaggaataatgagctattctgaagatggc
taccttgtagaacttataagcggaactcagtttaatttcccaataaaaaacaaaaatggc
tatttgataaacatagaaaaaatagattatatagctaagcttgcaaatagcgctctagtt
gatggaaggagaaagctagagaaacttaatcagtttttaaaggagaaggaaaatgagatc
cgataa

DBGET integrated database retrieval system