KEGG   Fervidicoccus fontis: FFONT_1204Help
Entry
FFONT_1204        CDS       T01936                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
ffo  Fervidicoccus fontis
Pathway
ffo00010  Glycolysis / Gluconeogenesis
ffo00020  Citrate cycle (TCA cycle)
ffo00620  Pyruvate metabolism
ffo00640  Propanoate metabolism
ffo00650  Butanoate metabolism
ffo00680  Methane metabolism
ffo00720  Carbon fixation pathways in prokaryotes
ffo01100  Metabolic pathways
ffo01120  Microbial metabolism in diverse environments
ffo01130  Biosynthesis of antibiotics
ffo01200  Carbon metabolism
Module
ffo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ffo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FFONT_1204
   00020 Citrate cycle (TCA cycle)
    FFONT_1204
   00620 Pyruvate metabolism
    FFONT_1204
   00640 Propanoate metabolism
    FFONT_1204
   00650 Butanoate metabolism
    FFONT_1204
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    FFONT_1204
   00680 Methane metabolism
    FFONT_1204
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    FFONT_1204
Enzymes [BR:ffo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     FFONT_1204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C GnsAB_toxin DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AFH43192
UniProt: I0A2I5
Position
complement(1151344..1152300)
Genome map
AA seq 318 aa AA seqDB search
MSSESKQLKNIFDIPREELFVGGHSMCAGCTAPIIIRHLLKVAGKNTIIVNATGCLEVST
TSFPYTAWKVPWIHVAFENTGAVASGVESAIKAMKMKGILDPNEEINIIAVAGDGGTFDI
GFQALSGMLERGHKVMYVLYDNEAYMNTGVQRSGGTPFGAWTTTTPVTKRIRGEWRNKKD
IFDIVIAHGVKYAAVANPAYTVDMMNKFKKGLEQEGPSFMHVLMPCTTGWRFDPKYGITI
ARLATETAIWINYEYDNGKLDVTIPVKKRKPVKEYLKMQGRYAHLNDVEISYIQEQVNKK
VEEVNKKVGREVIGPLEA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgagttctgaaagtaaacagctgaaaaatatatttgatataccaagggaagagctcttt
gtcggcgggcattcgatgtgcgctggatgcacagcgccaatcataattagacatttgtta
aaagttgcgggcaaaaacacaattatagtcaatgcaacaggatgtctcgaagtctcaaca
acttcatttccatatactgcttggaaagtgccttggatacatgtagcgtttgaaaacaca
ggtgcggttgcatcaggagtagagagcgcaataaaggcaatgaagatgaagggcatactt
gatccgaatgaagaaattaatattattgccgtcgctggcgatggaggaacatttgatata
ggctttcaagcattatctggcatgcttgaaagaggtcataaagtaatgtatgtattgtat
gataacgaagcatatatgaatactggtgttcagagaagcggtggaactccatttggagct
tggacaacgacaactccagtaactaaaagaataagaggagagtggagaaataaaaaagac
atctttgatatagttattgcgcatggagtgaagtacgcagcggtagcaaaccccgcatat
acagtcgatatgatgaataaattcaaaaaaggacttgaacaggaaggaccttcctttatg
catgtattaatgccatgcaccactgggtggagatttgatccgaaatatggaataaccatc
gcaagacttgctacagaaactgctatatggataaactatgaatatgacaatgggaagcta
gacgtaacgattccagttaaaaagaggaaacctgttaaagagtatctgaagatgcaagga
agatatgctcatctcaatgatgttgaaatatcatatatacaagaacaagttaacaaaaaa
gtcgaagaagttaacaaaaaagttgggagagaagttataggtcctcttgaagcttag

DBGET integrated database retrieval system