KEGG   Flavisolibacter ginsenosidimutans: FSB75_18295Help
Entry
FSB75_18295       CDS       T06122                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
fgg  Flavisolibacter ginsenosidimutans
Brite
KEGG Orthology (KO) [BR:fgg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    FSB75_18295 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: QEC57771
Position
4277299..4277685
Genome map
AA seq 128 aa AA seqDB search
MVSMISEGVKVSVETFYQQDYSNPLQSEFMFAYRITIENHNSFPVKLQSRHWHIFDSDGS
YREVEGEGVVGMQPVISAGEEYQYVSGCNLHTEMGRMQGAYLMENLHTKERFEVNIPAFE
MITPFKYN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcatgatttcggaaggagtgaaagtaagcgtggaaacattctatcagcaggac
tacagcaacccgttacaatcggagtttatgtttgcttaccgtataaccattgaaaatcat
aattcgtttccagtaaaattgcaaagccgtcactggcatatatttgattcagacggaagc
taccgcgaagtagaaggcgaaggcgtagtaggaatgcaacccgttatcagtgctggcgaa
gagtatcaatacgtaagcggctgtaatctgcacaccgaaatggggcgcatgcagggcgca
tacctgatggaaaatcttcacaccaaagaacgttttgaagtgaacataccggcttttgaa
atgattacaccgttcaaatacaattga

DBGET integrated database retrieval system