KEGG   Fimbriimonas ginsengisoli: OP10G_4346Help
Entry
OP10G_4346        CDS       T03038                                 

Definition
(GenBank) Pantothenate synthetase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
fgi  Fimbriimonas ginsengisoli
Pathway
fgi00410  beta-Alanine metabolism
fgi00770  Pantothenate and CoA biosynthesis
fgi01100  Metabolic pathways
fgi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fgi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OP10G_4346
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    OP10G_4346
Enzymes [BR:fgi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     OP10G_4346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_ligase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AIE87714
UniProt: A0A068NZ01
Position
complement(4748735..4749562)
Genome map
AA seq 275 aa AA seqDB search
MKIVRKARELPPPSHRSIGFVPTMGAFHEGHLDLMRRARRETDIVVVSLFVNPTQFGKGE
DFSRYPRDLDRDSAMAEGVGVDILFVPDVSEVYPHLPSTSIKVPEVSSRWEGAARPTHFE
GVATVVGKLFNMVRPDIAFFGQKDLQQCAVIRRMVEDLYFSVRLEICPTTREADGLAMSS
RNAYLSEDERRTAPALFRELTRCVNTFKSNSFVSTEVETELARSREELTSVGFDVDYFEW
VSYDDLLPVRDTSQASAVIVAAKIGRTRLIDNIVL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgaagatcgtccgcaaggcaagggagcttccgccgcctagtcatcgatcgattgggttc
gtgcccacgatgggtgctttccacgaggggcatctcgatttgatgcggagagcccgaagg
gagaccgatatcgtggtggtttcactcttcgtgaacccgactcagttcgggaaaggggaa
gacttcagccgttaccctcgcgacttagaccgcgactccgcgatggcggaaggcgtaggc
gtggacatcttgtttgtgcccgatgtttccgaggtttacccgcatctaccgtcgacatcg
atcaaggttccggaggtttccagtcgttgggaaggggcggcgcggccaactcacttcgaa
ggggttgccacggtggtaggcaaacttttcaacatggtacgaccggacattgcgttcttc
ggccagaaagatttgcaacaatgcgcggtgattcggcgaatggtcgaggatttgtatttt
tccgttcggctggagatttgcccaaccacccgagaagcggatgggctcgcgatgtcgagc
cggaacgcgtatttatccgaagatgagcgaagaaccgcgccggctttatttcgcgaattg
actcgttgcgtaaatacgtttaagtccaattcgttcgtgagtacggaagtagaaactgag
cttgctaggagtcgcgaagaactgacatcggtagggtttgacgtcgactatttcgaatgg
gtttcatacgatgacctgctcccggtgcgcgatacgtcacaagcttcggcggtgatcgtc
gccgcaaaaatcggtcgaacccgattgatcgataatattgttttgtag

DBGET integrated database retrieval system